logo
 
Displaying 241 - 270 of 47837 total results
twojawansofspecialtaskforcewerekilledinmaoistattackinchhattisgarh

Two Jawans Of Special Task Force Were Killed In Maoist Attack in Chhattisgarh

In Chhattisgarh, two jawans of the Special Task Force were killed in an attack by Maoists late last night. Four jawans have been injured in the incide...

maharashtracmeknathshindeannounces‘ladkabhau’jobtrainingandstipendschemeforyouthatpandharpur

Maharashtra CM Eknath Shinde Announces ‘Ladka Bhau’ Job Training And Stipend Scheme For Youth At Pandharpur

Maharashtra Chief Minister Eknath Shinde announced a job training and stipend scheme for youth, tentatively named ‘Ladka Bhau’ Yojana, days after it i...

poonchdistrictadministrationlaunchedriverraftingcampaignthisyear

Poonch District Administration Launched River Rafting Campaign This Year

In Jammu and Kashmir, in a move to promote tourism and adventure activities in the border district of Poonch, the district administration has again la...

12naxalskilledinmajorencounteronmaharashtrachhattisgarhborder

12 Naxals killed in major encounter on Maharashtra-Chhattisgarh border

At least 12 Naxals were killed in an encounter with police in Maharashtra's Gadchiroli district. Several automatic weapons were recovered from the Nax...

yogiadityanathgivessterninstructionstoministersaheadofbypollsinuttarpradesh

Yogi Adityanath gives stern instructions to ministers ahead of bypolls in Uttar Pradesh

Following a disappointing performance in the Lok Sabha elections, Chief Minister Yogi Adityanath convened a meeting with his cabinet ministers in Luck...

keralacopdragspetrolpumpstafferonbonnetfor1kmwontpayforfuel

Kerala Cop Drags Petrol Pump Staffer On Bonnet For 1km 'Won't Pay For Fuel'

A police officer in Kerala's Kannur district was suspended on Tuesday for attempting to mow down a petrol pump employee after being asked to make paym...

mansuffersheartattackandcollapsesatdelhiairportdoctorrescuesbygivingcpr

Man suffers Heart Attack and Collapses At Delhi Airport, doctor rescues by giving CPR

In a heroic act, a woman saved an elderly man who suffered heart attack at Delhi Airport on Wednesday. The video of the woman giving CPR to the elderl...

karnatakabusdriverhitsbullockcartfrombehindinjuringfarmersmakingreelwhiledriving

Karnataka Bus Driver Hits Bullock Cart From Behind Injuring Farmers 'Making Reel While Driving'

A government bus driver hit a bullock cart killing two bulls on the spot and severely injuring the farmers on it while making a reel in Karnataka’s Hu...

customerfindswormsinsidehighproteinbuttermilk‘stopbuyingproductsfromamul’

Customer Finds Worms Inside High Protein Buttermilk ‘Stop Buying Products From Amul’

Ordering dairy products has become risky nowadays, as worms and centipedes are found in the products delivered online. In another incident, worms were...

hindutvamobattackschristianprayermeetindehradunwhereisyoursindoor

Hindutva mob attacks Christian prayer meet in Dehradun 'Where is your sindoor'

A Christian prayer meeting was attacked by a Hindutva mob in Uttarakhand’s Dehradun district.The prayer meeting was being held in a residence on July ...

mansavesmynabyperformingcprinkeralabirdfliesaftertimelycare

Man Saves Myna By Performing CPR In Kerala, Bird Flies After Timely Care

A heartwarming video of a myna being rescued from the mouth of death has surfaced online. It showed a man spotting the bird fallen unconscious on the ...

muzaffarnagarhawkersputupsignboardswiththeirnamesonitaheadofkanwaryatra

Muzaffarnagar Hawkers Put Up Signboards With Their Names On It Ahead Of Kanwar Yatra

Hotels, restaurants, and hawkers doing business on the Kanwar Yatra route between Delhi and Haridwar have started to put up signboards to identify the...

videoofmpfarmerrollsonflooratcollectorsofficetoreclaimhisstolenland

Video of MP Farmer Rolls On Floor At Collector's Office To Reclaim His 'Stolen' Land

A 65-year-old farmer, identified as Shankarlal Patidar, started rolling on the floor with folded hands outside the Public Grievance room at the Collec...

nagpurmandrivescarwhilekissinggirlfriendseatedonhislaparrested

Nagpur Man Drives Car While Kissing Girlfriend Seated On His Lap, arrested

Police in Nagpur on Monday registered offense after a man was found to be driving a car with a woman on his lap who was hugging and kissing him. ...

delhihcreservesorderonkejriwal’spleasagainstcbiarrest

Delhi HC reserves order on Kejriwal’s pleas against CBI arrest

The Delhi High Court reserved on Wednesday its order on Chief Minister Arvind Kejriwal’s pleas challenging his arrest by the CBI in the excise policy ...

farmerdeniedentrytomallforwearingdhotiinkarnataka

Farmer denied entry to mall for wearing dhoti in Karnataka

Fakeerapan, a farmer by profession, had gone to enjoy a movie with his son Nagaraj at the G T Mall on Magadi Main Road in Bengaluru around 6 p.m. on J...

maharashtragovtannouncedladlabhaiyojnafortheyouth

Maharashtra govt announced 'Ladla Bhai Yojna' for the Youth

The Maharashtra government introduced a special scheme on the occasion of Ashadhi Ekadashi on Wednesday. This new scheme called 'Ladla Bhai Yojana' is...

pitbulldogsbrutallyattackdeliverymaninchhattisgarh

Pit Bull Dogs Brutally Attack Delivery Man In Chhattisgarh

A delivery man who entered a doctor's house in Anupam Nagar, Raipur, the capital of Chhattisgarh, was attacked and severely bitten by two pit bull dog...

policemenseendrinkingalcoholpartyinginsideofficeofdial112whileondutyinup

Policemen Seen Drinking Alcohol & Partying Inside Office Of Dial 112 While On Duty In UP

In a shocking incident that has come to light from Shamli district of Uttar Pradesh, a video of on duty policemen drinking alcohol and partying in the...

apcmmeetsamitshahappriseshimofstatesfinancialcrisis

AP CM Meets Amit Shah & Apprises Him Of State's Financial Crisis

Andhra Pradesh Chief Minister Chandrababu Naidu met Union Home Minister Amit Shah in Delhi on Tuesday and apprised him of the state's financial condit...

elderlymanwifeshotdeadbyminornephewinlucknow

Elderly man, wife shot dead by minor nephew in Lucknow

An elderly man and his wife were shot dead by their minor nephew here following an argument, police said on Wednesday. The couple's son was also injur...

muharramteachesnottocompromisewithinjusticesaysmamatabanerjee

Muharram teaches not to compromise with injustice, says Mamata Banerjee

Stating that Muharram teaches not to compromise with injustice, West Bengal Chief Minister Mamata Banerjee on Wednesday urged the people to follow the...

byjusfacesinsolvencyproceedingsforfailuretopayasponsorshipfeetocricketboardbcci

Byju's faces insolvency proceedings for failure to pay a sponsorship fee to cricket board BCCI

The Bengaluru bench of the National Company Law Tribunal (NCLT) on Tuesday allowed bankruptcy proceedings against Edtech firm Byju's after it failed t...

congresswillsnatchobcquotagiveittomuslimssaysamitshah

'Congress will snatch OBC quota, give it to Muslims', says Amit Shah

Union Home Minister Amit Shah on Tuesday said that the Bharatiya Janata Party (BJP) is going to form the government with full majority and cautioned a...

mehboobamuftisoldierscometokashmirfortheirdutybutgobackincoffins

Mehbooba Mufti 'Soldiers come to Kashmir for their duty but go back in coffins'

People's Democratic Party (PDP) chief Mehbooba Mufti on Tuesday said that from all over the country, soldiers come to Kashmir for their duty but go ba...

indianembassyinkuwaitrescuesandhramancheatedbyagent

Indian embassy in Kuwait rescues Andhra man cheated by agent

Human resource development minister Nara Lokesh said on Monday, July 15 that the Indian Embassy in Kuwait has come to the rescue of a distressed man f...

hindusenaconductsspecialhawanfordonaldtrumpswellbeing

Hindu Sena Conducts Special 'Hawan' For Donald Trump's Well-Being

In a gesture of solidarity and support, the Hindu Sena in New Delhi conducted a grand 'Hawan' aimed at ensuring the well-being and long life of former...

thievesburnrs135lakhwhilecuttingatmwithgascutterinmaharashtra

Thieves Burn Rs 13.5 Lakh While Cutting ATM With Gas Cutter in Maharashtra

Thieves attempted to break into the State Bank of India’s ATM located in the Maliwada area of Chhatrapati Sambhajinagar, Nashik Road, in the early hou...

healthdepartmentissuesalertfordenguemalariaingwalior

Health department issues alert for dengue-malaria in Gwalior

With the change in season, Dengue and Malaria are rapidly spreading in Madhya Pradesh's Gwalior district and the local health department has also issu...

aftermosquevandalismhousestorchedinmaharashtra

After mosque vandalism, houses torched in Maharashtra

Around 50-60 houses belonging to the minority community were attacked by a Hindutva mob on Sunday, July 16, following the vandalism of a mosque in Mah...

Displaying 241 - 270 of 47837 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which Women's cricket team will win the Asia Cup 2024?

India
Pakistan
Sri Lanka