logo
 
Displaying 22081 - 22110 of 58322 total results
secondarmycommandersconferencetobegintodaytobrainstormonemergingsecurity

Second Army Commanders Conference to begin today to brainstorm on emerging security

New Delhi: The Army Commanders’ Conference will begin in New Delhi today to brainstorm on current and emerging security and chart the future course fo...

schoolscollegesindiphuassamskarbiclosedduetodengueoutbreak

Schools, colleges in Diphu Assam's Karbi closed due to dengue outbreak

Guwahati: All schools and colleges in Diphu in Assam’s Karbi Anglong district were asked to remain shut next week due to dengue outbreak in the city, ...

inbengalurusoonspeedpostparcelstobecollectedfromyourdoorstep

In Bengaluru, Soon Speed Post parcels to be collected from your doorstep

BENGALURU: Letters or parcels to be sent through Speed Post to any part of the country from anywhere in the city could soon be picked up from your doo...

congressreleasespartymanifestoforhpassemblypolls

Congress releases party manifesto for HP assembly polls

Shimla: The Congress on Saturday released its manifesto for the November 12 Himachal Pradesh Assembly elections in the presence of Chhattisgarh Chief ...

firstvoterofindependentindiapassesawayinhimachal

First voter of independent India passes away in Himachal

Shimla: Shyam Saran Negi, 106, the first voter of independent India who cast his 34th vote for the forthcoming Assembly polls three days ago, passed a...

ecannouncesdatesforbypollsforparliamentaryassemblyconstituenciesin5states

EC announces dates for by-polls for Parliamentary, Assembly constituencies in 5 states

New Delhi: The Election Commission of India (ECI) on Saturday announced the dates of by-elections for the vacant Parliamentary and Assembly constituen...

totallunareclipseonnovember8

Total lunar eclipse on November 8

Weeks after the partial solar eclipse, parts of India will now witness a total lunar eclipse on November 8.According to experts, some parts of eastern...

guyanapresidentdrmohamedirfaanalitobechiefguestat17thpravasibharatiyadivasconventionatindore

Guyana President Dr. Mohamed Irfaan Ali to be chief guest at 17th Pravasi Bharatiya Divas Convention at Indore

New Delhi: Guyana President Dr. Mohamed Irfaan Ali will be the chief guest at the 17th Pravasi Bharatiya Divas Convention. It will be held from 8th to...

pmmoditoaddressralliesinsundarnagarsolaninhimachalpradeshtoday

PM Modi to address rallies in Sundar Nagar & Solan in Himachal Pradesh today

Shimla: Prime Minister Narendra Modi will visit Himachal Pradesh today, He will address an election rally in favor of BJP candidates today at Sunderna...

pmmoditovisitradhasoamisatsangbeasinamritsarpunjabtoday

PM Modi to visit Radha Soami Satsang Beas in Amritsar, Punjab today

Amritsar: Prime Minister Narendra Modi will visit the Radha Soami Satsang Beas in Amritsar, Punjab today. In a tweet, Mr. Modi said, under the le...

defenceministryextendsbenefitofproratapensiontojuniorcommissionedofficers

Defence Ministry extends benefit of pro-rata pension to Junior Commissioned Officers

New Delhi: Defence Ministry has extended the benefit of the provision of pro-rata pension to Junior Commissioned Officers with ten years of qualifying...

unionfinanceministernirmalasitharamantovisitthiruvananthapuraminkeralatoday

Union Finance Minister Nirmala Sitharaman to visit Thiruvananthapuram in Kerala today

Thiruvananthapuram: Union Finance Minister Nirmala Sitharaman will be on a day-long visit to Thiruvananthapuram in Kerala today, November 5. She will ...

presidentdroupadimurmutovisitchardhamtempleinnamchidistrictofsikkim

President Droupadi Murmu to visit Char Dham temple in Namchi district of Sikkim

Gangtok: On the final day of her two-day visit to Sikkim, President Droupadi Murmu will visit the famous Char Dham temple in the Namchi district today...

unionministerbhupenderyadavtoleadindiandelegationatcop27inegypt

Union Minister Bhupender Yadav to lead Indian delegation at COP 27 in Egypt

New Delhi: Environment, Forest, and Climate Change Minister Bhupender Yadav will lead Indian delegation to attend the 27th Session of Conference of Pa...

unionministerpiyushgoyalcallstoenhancebilateraltradedeepenculturalrelationsbetweenindiakyrgyzrepublic

Union Minister Piyush Goyal calls to enhance bilateral trade & deepen cultural relations between India & Kyrgyz Republic

New Delhi: Commerce and Industry Minister Piyush Goyal has called for enhancing bilateral trade and deepening cultural relations between India and the...

notificationforfirstphaseofassemblyelectionsingujarattobeissuedtoday

Notification for first phase of Assembly elections in Gujarat to be issued today

Notification for the first phase of the Gujarat Assembly elections will be issued today With this, the process of filling out the nomination form...

delhincraqicontinuestoremaininseverecategory

Delhi NCR AQI continues to remain in severe category

New Delhi: The air quality in Delhi and National Capital Region continued to be in the severe category.According to Central Pollution Control Board, t...

delhigovtclosesallprimaryschoolstillairpollutionlevelimprovesinnationalcapital

Delhi govt closes all primary schools till air pollution level improves in national capital

New Delhi: Delhi government has closed all primary schools in the national capital from today, November 5, till the air pollution level improves in th...

delhimcdelectionstobeheldon4thdeccountingtotakeplaceon7thdec

Delhi MCD elections to be held on 4th Dec, counting to take place on 7th Dec

New Delhi: The election of Municipal Corporation of Delhi, MCD will be held on 4th December and the counting of votes will take place on 7th December....

agricultureministersaysstubbleburningisaseriousproblem

Agriculture Minister says stubble burning is a serious problem

New Delhi: Agriculture Minister Narendra Singh Tomar has said that proper management of paddy stubble is the collective responsibility of all to preve...

bengaluruskempegowdainternationalairportregistershightrafficvolumeswith102%growthindomestictravel

Bengaluru's Kempegowda International Airport registers high traffic volumes with 102% growth in domestic travel

Bengaluru: The Kempegowda International Airport in Bengaluru has registered high traffic volumes with a 102 percent growth in domestic travel and 85 p...

shivsenaleadersudhirsurishotdeadoutsidetempleinamritsar;accusedarrested

Shiv Sena leader Sudhir Suri shot dead outside temple in Amritsar; accused arrested

AMRITSAR/CHANDIGARH: Punjab politician Sudhir Suri, a leader of Shiv Sena (Taksali), was on Friday shot dead by a shopkeeper while he was sitting on a...

gujaratassemblypoll2022:congressnamed43candidatesinfirstlist

Gujarat Assembly Poll 2022: Congress named 43 candidates in first list

Congress on Friday evening released the first list of 43 candidates for Gujarat Assembly elections. The list came after party president Mallikarj...

iknewiwillbeattackedsaysimrankhaninhisfirstpressconference

I knew I will be attacked, says Imran Khan in his first press conference

Former Pakistan Prime Minister and PTI (Pakistan Tehreek-e-Insaf) leader Imran Khan on Friday addressed a press conference for the first time after be...

motherdaughterduokilledasbouldertriggeredbylandslidehitshouseinjk

Mother-daughter duo killed as boulder triggered by landslide hits house in J&K

Jammu: A woman and her minor daughter died on Friday after a big boulder following a landslide hit their house in Jammu and Kashmir's Poonch district,...

eightfetusesfoundin21dayoldbaby

Eight fetuses found in 21-day-old baby

Ranchi: In a rare case, as many as eight fetuses were found in the abdomen of a 21-day-old baby during an operation in a private hospital here, doctor...

andhrapradeshchiefsecretarysameersharmahospitalisedagain

Andhra Pradesh Chief Secretary Sameer Sharma hospitalised again

Amaravati: Chief Secretary of Andhra Pradesh Government Sameer Sharma was hospitalised on Thursday after he fell ill during a review meeting at the Se...

11personskilled1injuredafteransuvcollidedwithbusinbetulmp

11 persons killed, 1 injured after an SUV collided with bus in Betul, MP

Betul: As many as 11 persons were killed and one person sustained injuries after an SUV they were travelling in collided with a bus near Jhallar polic...

15theditionofurbanmobilityindiaconferenceexpotoopeninkochitoday

15th edition of Urban Mobility India Conference & Expo to open in Kochi today

Kochi: The 15th edition of the Urban Mobility India Conference and Expo organised by the Ministry of Housing and Urban Affairs will open in Kochi toda...

defenceministerasksnavytomaintainfocusonfuturisticcapabilitydevelopmentinmaritimedomain

Defence Minister asks navy to maintain focus on futuristic capability development in maritime domain

New Delhi: Defence Minister Rajnath Singh has asked naval commanders to maintain focus on futuristic capability development for effectively overcoming...

Displaying 22081 - 22110 of 58322 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Can Lionel Messi's visit boost Indian football?

Yes
No
Can't Say