logo
 
Displaying 47521 - 47550 of 59935 total results
bjppresidentamitshahspeaksonmetoosayswilllookintoallegationsagainstmjakbar

BJP president Amit Shah speaks on MeToo, says will look into allegations against MJ Akbar

After days of silence, Bharatiya Janata Party (BJP) president Amit Shah has finally spoken on the allegations of sexual harassment against Union minis...

cyclonetitli:12killed4missingashideoutcavecrumblesinodisha

Cyclone Titli: 12 killed, 4 missing as hideout cave crumbles in Odisha

At least 12 tribals including three children in Gajapati district who had taken shelter in a cave near a hillock to escape the tail end of Cyclone Tit...

rahulgandhimeetshalemployeesslamscentreforsnatchingtheirrafaledeal

Rahul Gandhi meets HAL employees, slams Centre for snatching their Rafale deal

BENGALURU: Rahul Gandhi met employees of state-run Hindustan Aeronautics Limited or HAL today, amid allegations and counter-allegations over the Rafal...

chhattisgarh:congressmlaramdayaluikejoinsbjp

Chhattisgarh: Congress MLA Ram Dayal Uike joins BJP

RAIPUR: In what could be seen as a shot in the arm of the Bhartiya Janata Party ahead of the Chhattisgarh polls, a working president of the Congress a...

nobanonwomenenteringmosquesbutcan’tpraywithmen:keralajamiyyathulgensec

No ban on women entering mosques, but can’t pray with men: Kerala Jam-Iyyathul Gen Sec

After the Kerala-based Nisa, a progressive forum for Muslim women, demanded entry of women into mosques, Samastha Kerala Jam-Iyyathul General Secretar...

niacourtinmumbaihasorderedattachmentof4propertiesofzakirnaik

NIA court in Mumbai has ordered attachment of 4 properties of Zakir Naik

Mumbai’s special NIA court has ordered attachment of four properties belonging to absconding Islamic preacher Zakir Naik. During a hearing, the court ...

oneterroristkilledinencounterwithsecurityforcespulwamadistrict

One terrorist killed in encounter with security forces Pulwama district

In Jammu and Kashmir, one terrorist was killed in an encounter with security forces Pulwama district this morning. The identity of the terrorist is ye...

govtassurescountrynottofaceanyinternetshutdowninviewofreportsofglobaloutage

Govt assures, Country not to face any internet shutdown in view of reports of Global outage

A top government cyber security official has said that India will not face any internet shutdown, quashing fears of an internet blackout in the countr...

metofficewarnsveryheavyrainfallingangeticwestbengal

MeT office warns veryheavy rainfall in Gangetic West Bengal

The cyclonic storm Titli has weakened into deep depression over Odisha and has moved east-northeastwards.Director general of IMD K J Ramesh said, the ...

venkaiahnaidutovisitallahabadtoday

Venkaiah Naidu to visit Allahabad today

Vice President M. Venkaiah Naidu will visit Allahabad today to inaugurate the newly built annex of the High Court Building. Beside Chief Justice of th...

thirdphaseofmunicipalelectionsunderwayinjk

Third phase of municipal elections underway in J&K

The third phase of municipal elections is being held in Jammu division today.The polling begins 6 this morning and will conclude at 4 in the evening i...

ailingcmmanoharparrikarmeetsgoacabinetataiimsmayreturnduringdiwali

Ailing CM Manohar Parrikar meets Goa cabinet at AIIMS, may return during Diwali

Panaji: Goa Chief Minister Manohar Parrikar, who is undergoing treatment at AIIMS, on Friday met the Goa BJP core committee in New Delhi to review the...

ripwomenenteringsabarimalatempleinhalfsayskeralaactorkollamthulasi

Rip women entering Sabarimala temple in half, says Kerala Actor Kollam Thulasi

Kollam: Actor Kollam Thulasi made a bizarre statement on Friday saying women who come to enter the Sabarimala temple in Kerala, the revered shrine of ...

4retiredjudgestoholdpublichearingsof#metoocasessaysmanekagandhi

4 retired judges to hold public hearings of #MeToo cases,says Maneka Gandhi

New Delhi: With the #MeToo movement intensifying in the country with every passing day, Union Minister Maneka Gandhi on Friday said that four retired ...

on#metoorahulgandhisaystruthneedstobetoldloudandclear

On #MeToo, Rahul Gandhi says, Truth needs to be told loud and clear

Congress president Rahul Gandhi Friday came out in support of the #MeToo movement, saying it was about time that everyone learns to treat women with r...

keralahighcourtdismisseshinduoutfit’spleaforallowingmuslimwomeninmosques

Kerala High Court dismisses Hindu outfit’s plea for allowing Muslim women in mosques

The Kerala High Court Thursday dismissed a PIL filed by a Hindu group seeking entry of Muslim women into mosques for offering prayers. A division benc...

governmenthikescustomsdutyonmoreitemstoreinincurrentaccountdeficit

Government hikes customs duty on more items to rein in current account deficit

New Delhi: The government on Thursday increased customs duty on a host of items, including telecommunication equipment, to 20% from the existing 10%, ...

#metoomovement:smritiiraniputsonusonmjakbartorespondtoharassmentcharges

#MeToo movement: Smriti Irani puts onus on MJ Akbar to respond to harassment charges

Union minister Smriti Irani on Thursday put the onus on minister of state for external affairs MJ Akbar to respond to allegations of sexual harassment...

pmmodisayscongressdrovewedgebetweentelanganaandap

PM Modi says Congress drove wedge between Telangana and AP

Hyderabad: Prime Minister Narendra Modi on Thursday alleged that the Congress made the people of Telangana state and Andhra Pradesh states enemies.Add...

globalinternetshutdownlikelyovernext48hours:report

Global internet shutdown likely over next 48 hours: Report

NEW DELHI: Internet users across the globe may experience widespread network failures as the key domain servers are slated to undergo routine maintena...

naxalgunneddownbysecurityforcesinchhattisgarh

Naxal gunned down by security forces in Chhattisgarh

Raipur: One naxal was gunned down in an encounter with security forces in Sukma district of Chhattisgarh, police said Friday.The gunbattle took place ...

govthikesimportdutyoncertaincommunicationitemsupto20%

Govt hikes import duty on certain communication items up to 20%

The government has hiked import duty on certain communication items, including base stations, to up to 20 per cent. The Central Board of Indirect Taxe...

apcmchandrababunaiduappealsto15thfinancecommissiontoaccordspecialcategorystatustostate

AP CM Chandrababu Naidu appeals to 15th Finance Commission to accord special category status to state

The Andhra Pradesh Chief Minister N Chandrababu Naidu has appealed to 15th Finance Commission to accord special category status to the state. The chie...

statesutsreleaseover900prisonersaspartofcommemorationofthe150thbirthanniversaryofmahatmagandhi

States, UTs release over 900 prisoners as part of commemoration of the 150th Birth Anniversary of Mahatma Gandhi

The States and Union Territories, UTs have released over 900 prisoners as part of commemoration of the 150th Birth Anniversary of Mahatma Gandhi. ...

threedaysilverjubileecelebrationsofnhrcbegin

Three-day Silver Jubilee celebrations of NHRC begin

The three-day Silver Jubilee celebrations of the National Human Rights Commission (NHRC) will begin today to mark the occasion. The Commission is comp...

centreapprovesspecialpackageforfootwearandleathersector

Centre approves special package for footwear and leather sector

The Central Government has approved a special package for employment generation in leather and footwear sector. Centre has approved four projects wort...

presidentkovindtoinaugurate13thannualconventionofcictoday

President Kovind to inaugurate 13th Annual Convention of CIC today

President Ram Nath Kovind will inaugurate the 13th Annual Convention of the Central Information Commission in New Delhi today. The Convention will del...

cyclonetitlimovestowardsnortheastdirection

Cyclone Titli moves towards North East direction

The cyclonic storm TITILI is gradually weakening and moving towards the North East direction. Due to its effect, heavy rain with lightning lashed the ...

rafaledeal:rahulgandhicallspmmodicorruptman

Rafale deal: Rahul Gandhi calls PM Modi 'corrupt man'

NEW DELHI: Congress President Rahul Gandhi on Thursday called Prime Minister Narendra Modi corrupt following a French media report that said Reliance ...

itdeptsearchespremisesofmediabaronraghavbahl

IT dept searches premises of media baron Raghav Bahl

New Delhi: The Income Tax Department searched media baron Raghav Bahl's home and office on Thursday in connection with a case of alleged tax evasion, ...

Displaying 47521 - 47550 of 59935 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand