logo
 
Displaying 46261 - 46290 of 58665 total results
thirdphaseofmunicipalelectionsunderwayinjk

Third phase of municipal elections underway in J&K

The third phase of municipal elections is being held in Jammu division today.The polling begins 6 this morning and will conclude at 4 in the evening i...

ailingcmmanoharparrikarmeetsgoacabinetataiimsmayreturnduringdiwali

Ailing CM Manohar Parrikar meets Goa cabinet at AIIMS, may return during Diwali

Panaji: Goa Chief Minister Manohar Parrikar, who is undergoing treatment at AIIMS, on Friday met the Goa BJP core committee in New Delhi to review the...

ripwomenenteringsabarimalatempleinhalfsayskeralaactorkollamthulasi

Rip women entering Sabarimala temple in half, says Kerala Actor Kollam Thulasi

Kollam: Actor Kollam Thulasi made a bizarre statement on Friday saying women who come to enter the Sabarimala temple in Kerala, the revered shrine of ...

4retiredjudgestoholdpublichearingsof#metoocasessaysmanekagandhi

4 retired judges to hold public hearings of #MeToo cases,says Maneka Gandhi

New Delhi: With the #MeToo movement intensifying in the country with every passing day, Union Minister Maneka Gandhi on Friday said that four retired ...

on#metoorahulgandhisaystruthneedstobetoldloudandclear

On #MeToo, Rahul Gandhi says, Truth needs to be told loud and clear

Congress president Rahul Gandhi Friday came out in support of the #MeToo movement, saying it was about time that everyone learns to treat women with r...

keralahighcourtdismisseshinduoutfit’spleaforallowingmuslimwomeninmosques

Kerala High Court dismisses Hindu outfit’s plea for allowing Muslim women in mosques

The Kerala High Court Thursday dismissed a PIL filed by a Hindu group seeking entry of Muslim women into mosques for offering prayers. A division benc...

governmenthikescustomsdutyonmoreitemstoreinincurrentaccountdeficit

Government hikes customs duty on more items to rein in current account deficit

New Delhi: The government on Thursday increased customs duty on a host of items, including telecommunication equipment, to 20% from the existing 10%, ...

#metoomovement:smritiiraniputsonusonmjakbartorespondtoharassmentcharges

#MeToo movement: Smriti Irani puts onus on MJ Akbar to respond to harassment charges

Union minister Smriti Irani on Thursday put the onus on minister of state for external affairs MJ Akbar to respond to allegations of sexual harassment...

pmmodisayscongressdrovewedgebetweentelanganaandap

PM Modi says Congress drove wedge between Telangana and AP

Hyderabad: Prime Minister Narendra Modi on Thursday alleged that the Congress made the people of Telangana state and Andhra Pradesh states enemies.Add...

globalinternetshutdownlikelyovernext48hours:report

Global internet shutdown likely over next 48 hours: Report

NEW DELHI: Internet users across the globe may experience widespread network failures as the key domain servers are slated to undergo routine maintena...

naxalgunneddownbysecurityforcesinchhattisgarh

Naxal gunned down by security forces in Chhattisgarh

Raipur: One naxal was gunned down in an encounter with security forces in Sukma district of Chhattisgarh, police said Friday.The gunbattle took place ...

govthikesimportdutyoncertaincommunicationitemsupto20%

Govt hikes import duty on certain communication items up to 20%

The government has hiked import duty on certain communication items, including base stations, to up to 20 per cent. The Central Board of Indirect Taxe...

apcmchandrababunaiduappealsto15thfinancecommissiontoaccordspecialcategorystatustostate

AP CM Chandrababu Naidu appeals to 15th Finance Commission to accord special category status to state

The Andhra Pradesh Chief Minister N Chandrababu Naidu has appealed to 15th Finance Commission to accord special category status to the state. The chie...

statesutsreleaseover900prisonersaspartofcommemorationofthe150thbirthanniversaryofmahatmagandhi

States, UTs release over 900 prisoners as part of commemoration of the 150th Birth Anniversary of Mahatma Gandhi

The States and Union Territories, UTs have released over 900 prisoners as part of commemoration of the 150th Birth Anniversary of Mahatma Gandhi. ...

threedaysilverjubileecelebrationsofnhrcbegin

Three-day Silver Jubilee celebrations of NHRC begin

The three-day Silver Jubilee celebrations of the National Human Rights Commission (NHRC) will begin today to mark the occasion. The Commission is comp...

centreapprovesspecialpackageforfootwearandleathersector

Centre approves special package for footwear and leather sector

The Central Government has approved a special package for employment generation in leather and footwear sector. Centre has approved four projects wort...

presidentkovindtoinaugurate13thannualconventionofcictoday

President Kovind to inaugurate 13th Annual Convention of CIC today

President Ram Nath Kovind will inaugurate the 13th Annual Convention of the Central Information Commission in New Delhi today. The Convention will del...

cyclonetitlimovestowardsnortheastdirection

Cyclone Titli moves towards North East direction

The cyclonic storm TITILI is gradually weakening and moving towards the North East direction. Due to its effect, heavy rain with lightning lashed the ...

rafaledeal:rahulgandhicallspmmodicorruptman

Rafale deal: Rahul Gandhi calls PM Modi 'corrupt man'

NEW DELHI: Congress President Rahul Gandhi on Thursday called Prime Minister Narendra Modi corrupt following a French media report that said Reliance ...

itdeptsearchespremisesofmediabaronraghavbahl

IT dept searches premises of media baron Raghav Bahl

New Delhi: The Income Tax Department searched media baron Raghav Bahl's home and office on Thursday in connection with a case of alleged tax evasion, ...

edattacheskartichidambaramsassetsvaluers54crinindiaabroad

ED attaches Karti Chidambaram's assets value Rs.54 cr in India, abroad

New Delhi: The Enforcement Directorate Thursday said it has attached assets worth Rs 54 crore of Karti Chidambaram, son of former Finance Minister P C...

encounterunderwayinhandwarajk

Encounter underway in Handwara, J&K

Srinagar: Three militants, including scholar-turned-terrorist Manan Wani, are believed to have been trapped in an encounter at Handwara in frontier di...

pakistanviolatesceasefireinkrishnaghatisectoronejawaninjured

Pakistan violates ceasefire in Krishna Ghati sector, one jawan injured

POONCH: Pakistan violated ceasefire by firing on Indian posts in Krishna Ghati sector along the Line of Control (LoC) in Jammu and Kashmir's Poonch di...

homeministryissuesclarificationtoassamgovtoncitizenshipstatusofmembersofgorkhacommunity

Home Ministry issues clarification to Assam govt on citizenship status of members of Gorkha Community

Home Ministry has issued a clarification to the Assam government on the citizenship status of members of the Gorkha Community living in the state as p...

pmmodipayshomagetonanajideshmukhonhisbirthanniversary

PM Modi pays homage to Nanaji Deshmukh on his birth anniversary

Prime Minister Narendra Modi today paid homage to Nanaji Deshmukh on his birth anniversary. In a tweet, Mr Modi said, Nanaji Deshmukh worked tirelessl...

presidentkovindpaytributestoloknayakjayaprakashnarayanonhisbirthanniversary

President Kovind pay tributes to Loknayak Jayaprakash Narayan on his birth anniversary

President Ram Nath Kovind today paid tributes to Loknayak Jayaprakash Narayan on his birth anniversary. In a tweet, Mr Kovind said, a freedom fighter ...

eamsushmaswarajtoparticipatein17thchgmeetingofscotobeheldintajikistan

EAM Sushma Swaraj to participate in 17th CHG meeting of SCO to be held in Tajikistan

External Affairs Minister Sushma Swaraj will participate in the two-day meet of the Council of Heads of Government, CHG of the Shanghai Cooperation Or...

cyclonetitlimakeslandfallneargopalpurinodisha

Cyclone Titli makes landfall near Gopalpur in Odisha

The Cyclone Titli made landfall near Gopalpur in Odisha this morning. Several parts of Odisha are experiencing heavy rain as the Cyclone intensifies. ...

defenceministernirmalasitharamanbeginsthreedayvisittofrance

Defence Minister Nirmala Sitharaman begins three-day visit to France

Defence Minister Nirmala Sitharaman has left for Paris on a three-day visit to France. Officials sources said Ms Sitharaman will hold wide-ranging tal...

hinduorganisationsshutdown400meatshopsingurgaon

Hindu organisations shut down 400 meat shops in Gurgaon

Gurgaon: The Shiv Sena and another Hindu organisation claimed to have forcibly shut around 400 meat and chicken shops at different locations here on W...

Displaying 46261 - 46290 of 58665 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Can Lionel Messi's visit boost Indian football?

Yes
No
Can't Say