logo
 
Displaying 31321 - 31350 of 60346 total results
indianathleticslegendflyingsikhmilkhasinghpassesawayat91ofcovid19

Indian Athletics Legend 'Flying Sikh' Milkha Singh Passes Away at 91 of Covid-19

Milkha Singh, one of the biggest names in Indian sport and the country’s first track and field superstar, passed away after a month-long battle with C...

11montholdflowninfromdubaiwithmothersashesaftershelosesbattletocovid

11-month-old Flown in from Dubai With Mother's Ashes After She Loses Battle to Covid

An 11-month-old child on Thursday arrived in India from Dubai, carrying his mother's ashes, who died due to Covid-19.He was received at the Trichy Int...

42magnitudeearthquakehitsgujaratskutch

4.2 magnitude earthquake hits Gujarat's Kutch

An earthquake of magnitude 4.2 on the Richter Scale was felt in Gujarat's Kutch on Friday. The quake, which occurred at 3.45 p.m., had its epicentre n...

covidvaccinationlowerschancesofhospitalisationby7580percentsaysgovt

Covid vaccination lowers chances of hospitalisation by 75-80 per cent, says Govt

NEW DELHI: Studies have shown that after COVID-19 vaccination the chances of hospitalization among healthcare workers (HCWs) reduce by 75-80 per cent ...

shimlamansentencedtolifelongjailtermforrapeandmurderofminor:gudiyacase

Shimla Man Sentenced To Life-long Jail Term For Rape And Murder Of Minor: Gudiya Case

Almost three months after 28-year-old Anil Kumar, alias Neelu, a woodcutter, was convicted in the rape and murder case of 16-year-old school girl at K...

pmmodisaysgovtcommittedtoprovidecovid19vaccinetoeveryonefreeofcost

PM Modi Says Govt Committed to Provide COVID-19 Vaccine to Everyone Free of Cost

Prime Minister Narendra Modi has said that the Government is committed to provide free of cost Covid-19 vaccine to everyone. He said, vaccination cove...

pmmodilaunchescustomizedcrashcourseprogrammeforcovid19frontlineworkers

PM Modi Launches Customized Crash Course Programme for COVID-19 Frontline Workers

Prime Minister Narendra Modi today launched a Customized Crash Course programme for Covid-19 Frontline workers. With the launch, programme in 111 trai...

homeministryoperationalisesnationalhelplineforpreventingfinanciallossduetocyberfraud

Home Ministry operationalises National Helpline for preventing financial loss due to cyber fraud

Home Ministry has operationalised the national Helpline 155260 and Reporting Platform for preventing financial loss due to cyber fraud. The National H...

govtaimstoreduceroadaccidentdeathsby50percentby2024:nitingadkari

Govt aims to reduce road accident deaths by 50 percent by 2024: Nitin Gadkari

Minister for Road Transport and Highways Nitin Gadkari yesterday said, Government’s target is to reduce road accident deaths by 50 percent by 2024.&nb...

governmentnotinfavourofbanninganydigitalsocialplatformbytheyhavetofollowlaw:itminister

Government not in favour of banning any digital social platform by they have to follow law: IT Minister

Information Technology Minister Ravi Shankar Prasad emphasised that government is not in favour of banning any platform at the same time, they have to...

lgmanojsinhadirectsforestablishmentofyouthclubsineverypanchayatacrossjk

LG Manoj Sinha directs for establishment of Youth Clubs in every Panchayat across J&K

In the Union Territory of Jammu and Kashmir, Lieutenant Governor Manoj Sinha has directed for the establishment of Youth Clubs in every Panchayat acro...

maharashtragovttofilereviewpetitioninsupremecourtonmarathareservationissue

Maharashtra govt to file review petition in Supreme Court on Maratha Reservation issue

Maharashtra Government has decided to file a review petition in the Supreme Court on the Maratha Reservation issue. State Minister and Chairman of sub...

rajnathsinghdedicates12roadprojectsofborderroadorganisationtonation

Rajnath Singh dedicates 12 road projects of Border Road Organisation to Nation

Defence Minister Rajnath Singh on Thursday dedicated 12 roads to the nation, built by Border Roads Organisation in Northern and Eastern border areas. ...

privateagency2labsbookedforfakecovidreportsduringkumbh

Private agency, 2 labs booked for fake Covid reports during Kumbh

The Uttarakhand Police Thursday lodged an FIR against a private agency and two laboratories for allegedly issuing fake rapid antigen test reports duri...

orchardistsfrommadhyapradeshhiresecuritytopreventtheftofrarecostlymiyazakimangoes

Orchardists from Madhya Pradesh hire security to prevent theft of rare & costly Miyazaki Mangoes

Mango is the national fruit of India for several reasons, one being the myriad varieties that grow here. Adding to the list of Malihabadi Dasheris fro...

firagainstramdevforspreading‘falseinformation’onallopathy

FIR against Ramdev for spreading ‘false information’ on allopathy

Police in Chhattisgarh’s Raipur have registered an FIR against yoga guru Ramdev for allegedly spreading “false” information about the medicines being ...

nopenaltyfordrivingwithexpiredlicencesotherdocumentsuntilsept30

No penalty for driving with expired licences, other documents until Sept 30

The Centre has extended until September 30 the validity of driving licenses, vehicle registration certificates, fitness certificates, and all kinds of...

gstduesofallstatesnotclearedasclaimedbyfm:chidambaram

GST dues of all states not cleared as claimed by FM: Chidambaram

Senior Congress leader P Chidambaram on Wednesday said Finance Minister Nirmala Sitharaman is "wrong" in claiming that GST dues of states have been cl...

delhireceivesfreshstockofcovidvaccines:atishi

Delhi receives fresh stock of Covid vaccines: Atishi

New Delhi: With Delhi receiving fresh stock of COVID-19 vaccines from the Centre, people in the 18-44 age group can now book their slot on the CoWIN a...

twitterfailedtocomplywithitrules:prasad

Twitter failed to comply with IT rules: Prasad

New Delhi: IT Minister Ravi Shankar Prasad on Wednesday said Twitter failed to comply with intermediary guidelines and has "deliberately" chosen the p...

securitysteppedupontnkarnatakabordertocheckmaoistsmovement

Security stepped up on TN-Karnataka border to check Maoists movement

Erode: Security has been stepped up in some areas on the Tamil Nadu-Karnataka border following information that Maoists will infiltrate Tamil Nadu via...

ninepersonskilledincartruckcollisioningujarat

Nine persons killed in car-truck collision in Gujarat

Anand (Gujarat): Nine persons, including two children and as many  women, were killed when their car collided head-on with a goods-laden truck ne...

pmmodideliverskeynoteaddressatvivatech

PM Modi delivers keynote address at Viva Tech

New Delhi: Prime Minister Narendra Modi yesterday said India is adaptable and agile even in the middle of the pandemic.He pointed out that India imple...

pmcaresfundtrusttoallocaters4162croretoestablish2makeshiftcovidhospitalsbydrdoinwestbengal

PM CARES Fund Trust to allocate Rs.41.62 crore to establish 2 makeshift Covid Hospitals by DRDO in West Bengal

The Prime Minister’s Citizen Assistance and Relief in Emergency Situations (PM CARES) Fund Trust has decided to allocate Rs 41.62 crore for establishm...

pmmoditolaunchcustomizedcrashcourseprogrammetomorrow

PM Modi to launch Customized Crash Course Programme tomorrow

Prime Minister Narendra Modi will launch a Customized Crash Course Programme for COVID-19 Frontline Workers on Friday. The launch will commence the pr...

jaljeevanmissionbeingimplementedonprioritybasisinkargil

Jal Jeevan Mission being implemented on priority basis in Kargil

In Kargil, Jal Jeevan Mission is being implemented on priority basis focusing all blocks of the district and the execution of works in some villages o...

tamilnaducmmkstalininauguratesnewschemeforchildren

Tamil Nadu CM MK Stalin inaugurates new scheme for children

Tamil Nadu Chief Minister M. K. Stalin inaugurated a new scheme for children who have lost their parents due to COVID. The scheme assures five lakh ru...

karnatakapreparesroadmaptotacklepossible3rdwaveofcovid19pandemic

Karnataka prepares roadmap to tackle possible 3rd wave of Covid-19 pandemic

Karnataka has prepared a roadmap to tackle the possible third wave of the COVID-19 pandemic that is said to affect the children more. Karnataka Woman ...

bjpleadersfearofdatatheftexposedfaketestingracket

BJP leader's fear of data theft exposed fake testing racket

Bharatiya Janata Party's (BJP) Faridkot unit leader's fear of personal data theft after receiving a Covid-19 negative report without giving a swab sam...

firebreaksoutataiimsdelhisteachingblocknoinjuriesreported

Fire Breaks Out at AIIMS Delhi's Teaching Block, No Injuries Reported

Fire broke out at AIIMS Delhi’s conversion building on Wednesday night.Atul Garg, Director, Delhi Fire Services, said it’s a teaching block and there ...

Displaying 31321 - 31350 of 60346 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket teams will reach the IPL 2026 finals?

SRH and PBKS
RCB and RR
MI and DC