logo
 
Displaying 30691 - 30720 of 59730 total results
mplawyerjailedforsendingindecentbirthdaymessagetojudgegetsbail

MP lawyer, jailed for sending 'indecent' birthday message to judge, gets bail

A lawyer, who was in jail for the last four months for sending an "indecent" birthday message to a woman judge, has been granted bail by the Madhya Pr...

tamilnadugovtextendscoronarelieftosrilankannoncamptamilrefugeefamilies

Tamil Nadu Govt Extends Corona Relief to Sri Lankan Non-Camp Tamil Refugee Families

Chennai: Tamil Nadu Chief Minister M K Stalin on Saturday launched a scheme to provide monetary assistance of 4,000 each to 13,553 Sri Lankan Tamil re...

lakshadweepairporthousesfaceriskassealevelmayriseduetoclimatechange

Lakshadweep airport, houses face risk as sea level may rise due to climate change

The sea level is expected to rise around the Lakshadweep Islands in the range between 0.4 mm and 0.9 mm a year, according to a study based on projecti...

milkhasinghtobecrematedonsaturdayat5pm

Milkha Singh to be cremated on Saturday at 5 pm

Chandigarh: Milkha Singh, one of independent India's biggest sporting icons, who died of COVID-19 complications, will be cremated here on Saturday eve...

indiaandbhutaninkmoufordevelopingcooperationbetweentwocountries

India and Bhutan ink MoU for developing cooperation between two countries

India and Bhutan have inked a Memorandum of Understanding for developing cooperation between two countries in the area of environment. The MoU was sig...

nationcondolesdemiseofindiasprintlegendflyingsikhmilkhasingh

Nation condoles demise of India sprint legend flying Sikh Milkha Singh

Indian sprint legend flying Sikh Milkha Singh passed away last night after a month-long battle with COVID-19. He was 91. The Padma Shri awardee is sur...

governmentiscommittedtowardshealthsafetyandwelfareofworkers:santoshgangwar

Government is committed towards health, safety and welfare of workers: Santosh Gangwar

New Delhi: Minister of Labour and Employment Santosh Gangwar has said that the government is committed towards the health, safety and welfare of worke...

homeministeramitshahsaysallrounddevelopmentandwelfareofjkaretopprioritiesofnarendramodigovt

Home Minister Amit Shah says, all-round development and welfare of J&K are top priorities of Narendra Modi govt

Union Home Minister Amit Shah yesterday said, all-round development and welfare of Jammu and Kashmir are top priorities of Narendra Modi government. M...

ngthasgivengreensignaltomekedatuproject:bsyediyurappa

NGT has given green signal to Mekedatu project: B S Yediyurappa

Karnataka Chief Minister B. S. Yediyurappa has welcomed the decision of National Green Tribunal (NGT) to close the suo moto proceedings on forming a c...

madhyapradeshgovernmenttolaunchmegavaccinationdrivefromjune21

Madhya Pradesh Government to launch Mega Vaccination Drive from June 21

In Madhya Pradesh, the State Government has set a target of 10 lakh vaccinations on 21st of June. The State government will launch Mega Vaccination Dr...

maharashtraspwministerashokchavanaskscmuddhavthackeraytoalsorunproposedmumbaihyderabadbullettrainviamarathwada

Maharashtra's PW Minister Ashok Chavan asks CM Uddhav Thackeray to also run proposed Mumbai-Hyderabad bullet train via Marathwada

Maharashtra’s Public Works Minister Ashok Chavan yesterday met Chief Minister Uddhav Thackeray, seeking that the proposed Mumbai-Hyderabad bullet trai...

jklgmanojsinhaapprovesproposalofrecruitmentof800subinspectorsinjkpolice

J&K LG Manoj Sinha approves proposal of recruitment of 800 Sub Inspectors in J&K Police

Giving a fresh impetus to the recruitment process which had slowed down due to COVID pandemic, Jammu & Kashmir Lieutenant Governor, Manoj Sinha ye...

activistsupsetoverpolice‘advice’forwomentostayawayfromsocialmedia

Activists upset over police ‘advice’ for women to stay away from social media

COIMBATORE: Activists slammed the Police department after they issued an advisory to women asking them to stay off social media to ward off trouble. I...

bigconspiracy:jpnaddaaddressesbjpworkersreferstocalfserumissue

'Big conspiracy': JP Nadda addresses BJP workers, refers to 'calf serum' issue

Addressing BJP MPS and workers on Friday, BJP chief JP Nadda said there is a 'big conspiracy against the vaccination drive which every BJP leader has ...

indianathleticslegendflyingsikhmilkhasinghpassesawayat91ofcovid19

Indian Athletics Legend 'Flying Sikh' Milkha Singh Passes Away at 91 of Covid-19

Milkha Singh, one of the biggest names in Indian sport and the country’s first track and field superstar, passed away after a month-long battle with C...

11montholdflowninfromdubaiwithmothersashesaftershelosesbattletocovid

11-month-old Flown in from Dubai With Mother's Ashes After She Loses Battle to Covid

An 11-month-old child on Thursday arrived in India from Dubai, carrying his mother's ashes, who died due to Covid-19.He was received at the Trichy Int...

42magnitudeearthquakehitsgujaratskutch

4.2 magnitude earthquake hits Gujarat's Kutch

An earthquake of magnitude 4.2 on the Richter Scale was felt in Gujarat's Kutch on Friday. The quake, which occurred at 3.45 p.m., had its epicentre n...

covidvaccinationlowerschancesofhospitalisationby7580percentsaysgovt

Covid vaccination lowers chances of hospitalisation by 75-80 per cent, says Govt

NEW DELHI: Studies have shown that after COVID-19 vaccination the chances of hospitalization among healthcare workers (HCWs) reduce by 75-80 per cent ...

shimlamansentencedtolifelongjailtermforrapeandmurderofminor:gudiyacase

Shimla Man Sentenced To Life-long Jail Term For Rape And Murder Of Minor: Gudiya Case

Almost three months after 28-year-old Anil Kumar, alias Neelu, a woodcutter, was convicted in the rape and murder case of 16-year-old school girl at K...

pmmodisaysgovtcommittedtoprovidecovid19vaccinetoeveryonefreeofcost

PM Modi Says Govt Committed to Provide COVID-19 Vaccine to Everyone Free of Cost

Prime Minister Narendra Modi has said that the Government is committed to provide free of cost Covid-19 vaccine to everyone. He said, vaccination cove...

pmmodilaunchescustomizedcrashcourseprogrammeforcovid19frontlineworkers

PM Modi Launches Customized Crash Course Programme for COVID-19 Frontline Workers

Prime Minister Narendra Modi today launched a Customized Crash Course programme for Covid-19 Frontline workers. With the launch, programme in 111 trai...

homeministryoperationalisesnationalhelplineforpreventingfinanciallossduetocyberfraud

Home Ministry operationalises National Helpline for preventing financial loss due to cyber fraud

Home Ministry has operationalised the national Helpline 155260 and Reporting Platform for preventing financial loss due to cyber fraud. The National H...

govtaimstoreduceroadaccidentdeathsby50percentby2024:nitingadkari

Govt aims to reduce road accident deaths by 50 percent by 2024: Nitin Gadkari

Minister for Road Transport and Highways Nitin Gadkari yesterday said, Government’s target is to reduce road accident deaths by 50 percent by 2024.&nb...

governmentnotinfavourofbanninganydigitalsocialplatformbytheyhavetofollowlaw:itminister

Government not in favour of banning any digital social platform by they have to follow law: IT Minister

Information Technology Minister Ravi Shankar Prasad emphasised that government is not in favour of banning any platform at the same time, they have to...

lgmanojsinhadirectsforestablishmentofyouthclubsineverypanchayatacrossjk

LG Manoj Sinha directs for establishment of Youth Clubs in every Panchayat across J&K

In the Union Territory of Jammu and Kashmir, Lieutenant Governor Manoj Sinha has directed for the establishment of Youth Clubs in every Panchayat acro...

maharashtragovttofilereviewpetitioninsupremecourtonmarathareservationissue

Maharashtra govt to file review petition in Supreme Court on Maratha Reservation issue

Maharashtra Government has decided to file a review petition in the Supreme Court on the Maratha Reservation issue. State Minister and Chairman of sub...

rajnathsinghdedicates12roadprojectsofborderroadorganisationtonation

Rajnath Singh dedicates 12 road projects of Border Road Organisation to Nation

Defence Minister Rajnath Singh on Thursday dedicated 12 roads to the nation, built by Border Roads Organisation in Northern and Eastern border areas. ...

privateagency2labsbookedforfakecovidreportsduringkumbh

Private agency, 2 labs booked for fake Covid reports during Kumbh

The Uttarakhand Police Thursday lodged an FIR against a private agency and two laboratories for allegedly issuing fake rapid antigen test reports duri...

orchardistsfrommadhyapradeshhiresecuritytopreventtheftofrarecostlymiyazakimangoes

Orchardists from Madhya Pradesh hire security to prevent theft of rare & costly Miyazaki Mangoes

Mango is the national fruit of India for several reasons, one being the myriad varieties that grow here. Adding to the list of Malihabadi Dasheris fro...

firagainstramdevforspreading‘falseinformation’onallopathy

FIR against Ramdev for spreading ‘false information’ on allopathy

Police in Chhattisgarh’s Raipur have registered an FIR against yoga guru Ramdev for allegedly spreading “false” information about the medicines being ...

Displaying 30691 - 30720 of 59730 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand