logo
 
Displaying 12751 - 12780 of 25269 total results
egypt:dakahliagovernorinfectedwithcoronavirus

Egypt: Dakahlia Governor infected with Coronavirus

Ayman al-Mukhtar, the governor of Dakahlia in Egypt, said today, Monday, that the smear taken from the new Coronavirus is positive.The General Office ...

diedduringtarawihprayer:sheikhsalehkamel

Died during Tarawih prayer: Sheikh Saleh Kamel

The famous businessman Sheikh Saleh Kamel, the owner of ART and Arab TV Group, died at the age of 79, after he suffered a stroke during the performanc...

indiabecomes11thcountrytocross100kcoronaviruscasesmatchingnumberoficubeds

India becomes 11th country to cross 100K coronavirus cases, matching number of ICU beds

Coronavirus cases in India reached 100,000 on Tuesday, matching its number of intensive care beds, and the rate of increase of new infections showed l...

indiabangladeshevacuatemillionsaheadofcycloneamidvirusfears

India, Bangladesh evacuate millions ahead of cyclone amid virus fears

India and Bangladesh began evacuating more than two million people Monday as a cyclone barreled towards their coasts, with officials racing to ready e...

trumpthreatenspermanentfreezeonwhofundingin30days

Trump threatens permanent freeze on WHO funding in 30 days

Washington: President Donald Trump threatened to permanently freeze US funding to the World Health Organisation unless “substantive improvements” were...

fourkilledasquakehitsyunnanprovinceinchina

Four killed as quake hits Yunnan province in China

Beijing: An earthquake has struck China’s southwestern Yunnan province, killing at least four people and injuring 24 others, according to officials.On...

bangladeshraisesdangersignalstolevel7atmonglaasamphanmovescloser

Bangladesh raises danger signals to level 7 at Mongla as Amphan moves closer

The Met department of Bangladesh has raised the danger signal to seven at the maritime ports of Mongla and Payara as the cyclone Amphan intensified in...

economicrecoverymaystretchtilltheendof2021:usfedchiefpowell

Economic recovery may stretch till the end of 2021: US Fed Chief Powell

The US economy will recover from the COVID-19 pandemic, but the process could stretch through until the end of 2021, Federal Reserve Chairman Jerome P...

despitelockdownsugarmillscontractfor42milliontonnesofexports

Despite lockdown, sugar mills contract for 4.2 million tonnes of exports

Amid the twin headwinds of lockdown and falling sugar demand, the domestic sugar mills have contracted for exports totalling 4.2 million tonnes (MT) t...

ukdrugmakeraimsfor30millioncoronavirusvaccinedosesbyseptember

UK drugmaker aims for 30 million coronavirus vaccine doses by September

AstraZeneca Plc will make as many as 30 million doses of vaccine available to the UK by September and has committed to delivering 100 million doses th...

122countrieswantaninvestigationintohowthecoronavirusoutbreakhappenedbutchinasaysitspremature

122 COUNTRIES WANT AN INVESTIGATION INTO HOW THE CORONAVIRUS OUTBREAK HAPPENED, BUT CHINA SAYS ITS 'PREMATURE'

A spokesperson for China's foreign ministry has said it is too early to allow an independent investigation into the origins and spread of the COVID-19...

chinaaskedfoodcompaniestoboostsupplyinfearofsecondwaveofcoronavirus

China asked food companies to boost supply in fear of second wave of Coronavirus

China has asked trading firms and food processors to boost inventories of grains and oilseeds as a possible second wave of coronavirus cases and worse...

morethan10firefightersinjuredinlosangelesbuildingexplosion

More than 10 firefighters injured in Los Angeles building explosion

Eleven firefighters in the United States have been injured after a fire in a commercial building caused an explosion and spread to nearby structures, ...

uscomedianfredwillardpassesawayaged86

US comedian Fred Willard passes away aged 86

Four-time Emmy award-winning comedian Fred Willard, who appeared in films including "Anchorman" and "This is Spinal Tap" and television shows such as ...

thirteenussailorsinfectedwithcovid19testpositiveforasecondtime

Thirteen US sailors infected with Covid-19 test positive for a second time

All the sailors had previously tested positive for the virus and had gone through at least two weeks of isolation.Before they were allowed to go back ...

worldfoodprogrammesays93millionpeoplefoodinsecureinwartornsyria

World Food Programme Says, 9.3 Million People Food Insecure in War-torn Syria

A record 9.3 million people are now food insecure in Syria as spiralling prices and the coronavirus pandemic compound the damage of a nine-year war, t...

vijaymallyaofferstorepayhisloandues:pleasetakemymoneyunconditionallyandcloseit

Vijay Mallya offers to repay his loan dues: Please take my money unconditionally and close it

London: Vijay Mallya has once again offered to repay his loan amount dues to the government. Tweeting about the same he asked the government to accept...

europeancountriesdeclaredcovid19isoveropenborders

European countries declared Covid-19 is over, open borders

Slovenia opened its borders today after declaring an end to its coronavirus epidemic, despite new infections still being reported."Today Slovenia has ...

usprezdonaldtrumprulesoutrenegotiatingtradedealwithchina

US Prez Donald Trump rules out renegotiating trade deal with China

US President Donald Trump has ruled out renegotiating the trade deal with China. He expressed disappointment over Beijing's handling of the coronaviru...

wtochiefrobertoazevedodecidestoresignayearbeforehistermexpires

WTO Chief Roberto Azevedo decides to resign a year before his term expires

The Head of the World Trade Organization (WTO) Roberto Azevedo has decided to resign, a year before his term expires. Mr Azevedo, a former diplomat fr...

fivekilled14injuredineasternafghancityblast

Five killed, 14 injured in eastern Afghan city blast

A truck packed with explosives blew up near a court in the eastern Afghan city of Gardez on Thursday, killing at least five people, two days after gun...

firstcoronavirusantibodytestapprovedinukis100%accurate

First coronavirus antibody test approved in UK is '100% accurate'

Public Health England (PHE) said scientific experts at its Porton Down facility had carried out an independent evaluation of the new coronavirus blood...

typhoonforcesriskyevacuationsincoronavirushitphilippines

Typhoon forces risky evacuations in coronavirus-hit Philippines

powerful typhoon hit the central Philippines Thursday, forcing a complicated and risky evacuation for tens of thousands already hunkered down at home ...

coronavirus‘maynevergoaway’couldbecomeanendemicsayswho

Coronavirus ‘may never go away’, could become an endemic, says WHO

The World Health Organization on Wednesday said the novel coronavirus “may never go away” and that people will have to learn to live with it. Covid-19...

morethan300lawmakersurgeimfworldbanktocanceldebtofpoorcountriesamidpandemic

More Than 300 Lawmakers Urge IMF, World Bank to Cancel Debt of Poor Countries Amid Pandemic

Over 300 lawmakers from around the world on Wednesday urged the International Monetary Fund and World Bank to cancel the debt of the poorest countries...

spain’soldestwoman113overcomescovid19

Spain’s oldest woman, 113, overcomes COVID-19

A 113-year-old woman, believed to be the oldest person living in Spain, has beaten the coronavirus at a retirement home where several other residents ...

coronavirus:japanesesumowrestlerdiesat28

Coronavirus: Japanese sumo wrestler dies at 28

A 28-year-old Japanese sumo wrestler infected with the virus has died, the Japan Sumo Association (JSA) has announced, the first in the sport to fall ...

twittermakesitofficialtoletemployeesworkfromhomeforever

Twitter makes it official to let employees work from home 'forever'

San Francisco: Twitter has made it official to let its employees work from home forever if they chose to and they will be paid like a normal working d...

russiasaysitwillopposeanyusattemptstoextendarmsembargooniran

Russia says it will oppose any US attempts to extend arms embargo on Iran

Russia has said it will oppose any attempts by the United States to extend the arms embargo on Iran and reimpose UN sanctions against the Islamic Repu...

unchiefextendstelecommutingarrangementsatworldbodyshqsthroughjune30

UN chief extends Telecommuting arrangements at world body's HQs through June 30

United Nations chief Antonio Guterres has extended the telecommuting arrangements at the world body's headquarters through June 30 in the wake of the ...

Displaying 12751 - 12780 of 25269 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Is it right to exclude Bangladesh from the T20 World Cup?

Yes
No
Can't Say