logo
 
Displaying 9661 - 9690 of 20061 total results
rtpcrtestofkcrdidntshowconcreteresult:drmvrao

RT-PCR test of KCR didn't show concrete result: Dr MV Rao

The Rapid Antigen Test and RT-PCR test conducted on Chief Minister K Chandrashekhar Rao have given mixed results.In the rapid test, Chandrashekhar Rao...

nolockdownrecommendedintelangana:drgsrinivasarao

No lockdown recommended in Telangana: Dr G Srinivasa Rao

Director of Public Health Dr G Srinivasa Rao on Wednesday clarified that the Health department had not recommended imposing a lockdown to the State go...

hmmahmoodaliwarnspeopleagainstblackmarketingofoxygencylinders

HM Mahmood Ali warns people against black-marketing of oxygen cylinders

Home Minister Mohammed Mahmood Ali said on Wednesday that the police will take stern action against those who indulge in hoarding and black marketing ...

hyundaiannouncescovidreliefinitiatives

Hyundai announces Covid relief initiatives

Hyundai Motor India Foundation (HMIF), the philanthropic wing of Hyundai Motor India, announced a series of initiatives to help fight Covid-19 in Tela...

ghmcscovidcontrolroomabuzzwithcalls

GHMC's Covid control room abuzz with calls

At a time when reliable information pertaining to hospitals, vaccination centres and health-related queries top the necessity chart amid Covid-19 seco...

10000oxygenlineshelpmeetdemandintelangana

10,000 oxygen lines help meet demand in Telangana

Medical oxygen lines installed in 10,000 hospital beds in government hospitals across Telangana during the first wave of Covid pandemic has ensured th...

twomunicipalcorporationsandfivemunicipalitiespollingtobeheldtomorrow

Two Municipal Corporations and five Municipalities polling to be held tomorrow

Amidst Covid-19 pandemic, the State Election Commission (SEC) has made elaborate arrangements to enable over 11.59 lakh voters including 5.84 lakh wom...

cmkcrtestsnegativeforcovid19

CM KCR tests negative for Covid-19

Telangana Chief Minister K Chandrashekhar Rao has tested negative for Covid-19 on Wednesday, after being in isolation for the last one week.According ...

privatehospitalsmustfollowpricecappingguidelines:healthminister

Private hospitals must follow price capping guidelines: Health Minister

The Health Minister Eatala Rajender on Tuesday asked the private hospitals to follow the price capping guidelines that were fixed during the first wav...

trsfoundationdaycelebratedacrosstelangana

TRS Foundation day celebrated across Telangana

For the second consecutive year, the foundation day celebrations of the Telangana Rashtra Samithi (TRS) was a muted affair across the State on Tuesday...

over2lakhvaccinatedintelanaganaonmonday

Over 2 lakh vaccinated in Telanagana on Monday

Efforts to ramp-up Covid vaccination in Telangana have continued with authorities successfully administering Covid vaccine to 2,15,294 individuals on ...

cmkcrtodecideoncovidlockdownsoon

CM KCR to decide on Covid lockdown soon

In the wake of a steep increase in COVID-19 cases in the State, people, especially those from middle and lower middle classes, are inquiring whether t...

maheshbhagwatlaunchesfourcabsinrachakonda

Mahesh Bhagwat launches four cabs in Rachakonda

Four cabs in LB Nagar zone and Bhongir zone of the Rachakonda Commissionerate were launched by Rachakonda Police Commissioner Mahesh Bhagwat here on M...

temperaturesinchcloseto40degreecelsiusinhyderabad

Temperatures inch close to 40 degree Celsius in Hyderabad

The day time temperatures in Hyderabad on Monday increased substantially with several automatic weather stations (AWS) recording temperatures of over ...

rachakondapoliceholdtrafficawareness

Rachakonda Police hold traffic awareness

The Traffic Marshals of the Rachakonda Police organised a traffic awareness programme in different areas of Malkajgiri on Monday.The group highlighted...

telanganareceivesfirstbatchofmedicaloxygenfromodisha

Telangana receives first batch of medical oxygen from Odisha

Telangana on Monday received the first batch of tankers loaded with medical oxygen, meant for Covid-19 positive patients from Rourkela Steel Plant of ...

telanganagovttodistribute45lakhramzangiftpacks

Telangana govt to distribute 4.5 lakh Ramzan gift packs

The State government will be distributing 4.5 lakh Ramzan gift packs at 815 mosques across the Telangana.Mohammed Mahmood Ali, Home Minister, flagged ...

aiimsbibinagartostartcovidcarecentreonapril29

AIIMS Bibinagar to start Covid Care Centre on April 29

Yadadri-Bhongir: The All India Institute of Medical Sciences (AIIMS), Bibinagar, will set up level 1 Covid Care Centre to manage mild to moderate case...

eatalarajenderdirectstheseniorhealthofficialstofocusonprovidingpropersupporttocovidpositivepatients

Eatala Rajender directs the senior health officials to focus on providing proper support to Covid positive patients

Healthcare workers in government hospitals across Telangana should ensure that no lives were lost due to the ongoing pandemic, Health Minister, Eatala...

cmclearsappointmentofhealthcareofficials

CM clears appointment of healthcare officials

Chief Minister K Chandrashekhar Rao on Sunday took a key decision to appoint adequate staff in 114 hospitals in Telangana on a war-footing in view of ...

dyspeakerarrangesremdesivirfreeofcostforpoorpatients

Dy Speaker arranges Remdesivir free of cost for poor patients

Deputy Speaker T Padma Rao on Sunday made arrangements for supply of Remdesivir injections free of cost for Covid-19 patients under emergency services...

unionministerkishanreddyvisitsesihospital

Union Minister Kishan Reddy visits ESI hospital

Union Minister of State for Home Affairs, G Kishan Reddy visited TIMS Hospital, Gachibowli, and ESI Hospital and Medical College, Sanathnagar on Sunda...

225policeofficialsunderrachakondapslimitstestpositive

225 Police Officials Under Rachakonda PS Limits Test Positive

Around 225 coronavirus cases have been reported among the police officials of Rachakonda police station limits, said the Commissioner of Police Mahesh...

municipalelectionsintelanganawillbeheldasscheduledonapril30

Municipal elections in Telangana will be held as scheduled on April 30

The State Election Commission (SEC) said on Thursday that the municipal elections in Telangana will be held as scheduled on April 30, but imposed furt...

ktrtestspositiveforcovid19

KTR tests positive for Covid-19

IT and Industries Minister KT Rama Rao has tested positive for Covid-19.In a tweet on Friday, the Minister said: “I have tested Covid positive with mi...

healthministereatalarajenderexpressesdispleasureatthewayremdesivirandoxygenallotedtotelangana

Health Minister Eatala Rajender expresses displeasure at the way Remdesivir and oxygen alloted to Telangana

Health Minister Eatala Rajender on Thursday expressed displeasure at the way Remdesivir and oxygen for Covid-19 patients were allotted to Telangana ba...

63containmentzonesinhyderabad

63 containment zones in Hyderabad

With the spike in Covid-19 cases, the GHMC has identified 63 containment zones in various places under LB Nagar, Charminar, Khairatabad and Serilingam...

gandhihospitalofficialsdispelrumoursonshortageofoxygen

Gandhi Hospital officials dispel rumours on shortage of oxygen

Gandhi Hospital Superintendent Dr M Raja Rao on Wednesday said there was no shortage of oxygen meant for critical Covid-19 patients and urged patients...

cmkcrshealthconditionstable:doctors

CM KCR's health condition stable: doctors

Chief Minister K Chandrashekhar Rao underwent a CT scan and other medical tests as part of general health check-up at Yashoda Hospitals in Somajiguda ...

hyderabadmayorinspectssanitationworksincityforfourthconsecutiveday

Hyderabad Mayor inspects sanitation works in city for fourth consecutive day

For the fourth consecutive day, Mayor Gadwal Vijayalakshmi inspected sanitation works in Kukatpally, Khairatabad and Serilingampally zones as part of ...

Displaying 9661 - 9690 of 20061 total results

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Do you think Ruturaj Gaikwad would be a good captain for Chennai Super Kings?

Yes
No
Can't Say