logo
 
Displaying 26071 - 26100 of 123476 total results
unionhealthministerjpnaddaheldareviewmeetingondrugcosmeticandmedicaldeviceregulations

Union Health Minister JP Nadda Held A Review Meeting On Drug, Cosmetic, And Medical Device Regulations

Health and Family Welfare Minister JP Nadda has stressed to create a world-class drug regulatory framework to match the country’s reputation of Pharma...

unionministermanoharlalkhattarchairshighlevelmeetingatdvcheadquartersinkolkata

Union Minister Manohar Lal Khattar Chairs High-Level Meeting At DVC Headquarters In Kolkata

Union Minister of Power Manohar Lal Khattar yesterday chaired a high level meeting in Kolkata at Damodar Valley Corporation (DVC) headquarters. Khatta...

haryanagovernmentannouncesreservationandagerelaxationforagniveersinpoliceandotherdepartments

Haryana Government Announces Reservation And Age Relaxation For Agniveers In Police And Other Departments

Haryana government will provide 10 percent horizontal reservation to Agniveers in recruitment to certain posts in police, mining and jail departments....

thebook‘wingstoourhopesvolumei’onpresidentdroupadimurmu’s75significantspeecheswillbereleasedtoday

The Book ‘Wings To Our Hopes, Volume I,’ On President Droupadi Murmu’s 75 Significant Speeches Will Be Released today

The book ‘Wings to Our Hopes, Volume I,’ which compiles 75 significant speeches from the first year of President Droupadi Murmu’s tenure, will be rele...

over13000pilgrimspaidobeisancetoshriamarnathji

Over 13,000 Pilgrims Paid Obeisance To Shri Amarnath Ji

In the Kashmir Valley, over 13,000 pilgrims paid obeisance of Ice Shivlingam in the Himalayan cave of Shri Amarnath Ji situated at an altitude of 3888...

governmentrevisescompositionofnitiaayog

Government Revises Composition Of NITI Aayog

The Government has revised the composition of NITI Aayog. Defence Minister Rajnath Singh has been included as an Ex-Officio Member along with Home Min...

governmentconvenesallpartymeetingonsundayaheadofthebudgetsessionofparliament

Government Convenes All-Party Meeting On Sunday Ahead Of The Budget Session Of Parliament

The government has convened an all-party meeting on Sunday ahead of the Budget Session of Parliament. During the meeting, the government will seek coo...

primeministernarendramodihailsmakeinindiasuccessstoryforglobaleconomicboost

Prime Minister Narendra Modi Hails Make In India Success Story For Global Economic Boost

Prime Minister Narendra Modi has shared a glimpse through social media of how ‘Make In India’ propels India’s economy onto the global stage. The threa...

anotherbatchleftbhagwatinagaryatriniwasbasecamptoperformpilgrimagetoamarnathcaveshrine

Another Batch Left Bhagwati Nagar Yatri Niwas Base Camp To Perform Pilgrimage To Amarnath Cave Shrine

Another batch of 4383 pilgrims left Bhagwati Nagar Yatri Niwas base camp in Jammu for the Kashmir valley to perform pilgrimage to Amarnath Cave Shrine...

nerellasharadatookchargeaschairpersonoftelanganastatewomen’scommission

Nerella Sharada Took Charge As Chairperson Of Telangana State Women’s Commission

Women’s rights activist Nerella Sharada took charge as the chairperson of the Telangana State Women’s Commission in Hyderabad yesterday. A government ...

karnatakagovtdecidedtoputonholdthedraftbillthatensuredjobquotasforkannadigasinprivatesector

Karnataka Govt Decided To Put On Hold The Draft Bill That Ensured Job Quotas For Kannadigas In Private Sector

The Karnataka government has decided to put on hold the draft bill that ensured job quotas for Kannadigas in the private sector after industry bodies ...

jkpolicelaunchedmajorcrackdownonnetworkofovergroundworkersinconnectionwithdodaterrorattacks

J&K Police Launched Major Crackdown On Network Of Overground Workers In Connection With Doda Terror Attacks

Jammu and Kashmir police have launched a major crackdown on the network of overground workers (OGWs) in connection with a series of terror attacks in ...

twojawansofspecialtaskforcewerekilledinmaoistattackinchhattisgarh

Two Jawans Of Special Task Force Were Killed In Maoist Attack in Chhattisgarh

In Chhattisgarh, two jawans of the Special Task Force were killed in an attack by Maoists late last night. Four jawans have been injured in the incide...

maharashtracmeknathshindeannounces‘ladkabhau’jobtrainingandstipendschemeforyouthatpandharpur

Maharashtra CM Eknath Shinde Announces ‘Ladka Bhau’ Job Training And Stipend Scheme For Youth At Pandharpur

Maharashtra Chief Minister Eknath Shinde announced a job training and stipend scheme for youth, tentatively named ‘Ladka Bhau’ Yojana, days after it i...

poonchdistrictadministrationlaunchedriverraftingcampaignthisyear

Poonch District Administration Launched River Rafting Campaign This Year

In Jammu and Kashmir, in a move to promote tourism and adventure activities in the border district of Poonch, the district administration has again la...

12naxalskilledinmajorencounteronmaharashtrachhattisgarhborder

12 Naxals killed in major encounter on Maharashtra-Chhattisgarh border

At least 12 Naxals were killed in an encounter with police in Maharashtra's Gadchiroli district. Several automatic weapons were recovered from the Nax...

instegrescued8indiansamongnineafteroiltankercapsizesoffoman

INS Teg rescued 8 Indians among nine after oil tanker capsizes off Oman

In the latest development, the Indian Navy warship INS Teg on Wednesday rescued eight Indians who went missing after an oil tanker capsized off the co...

muslimsacrosstelanganaobserve‘youmeashoora’

Muslims across Telangana observe ‘Youm-e Ashoora’

Muslims across Telangana on Wednesday observed the ‘Youm-e Ashoora’ that falls on the tenth day of Muharram, the first month of the Hijri calendar. Th...

govttowaivecroploansinthreespellsfromjuly18:cmrevanth

Govt to waive crop loans in three spells from July 18: CM Revanth

The State government has decided to implement the crop loan waiver scheme in three spells commencing from Thursday.While the loans upto Rs.1 lakh will...

brsretaliateswithstingingreplytobjp’spoachingjabonx

BRS retaliates with stinging reply to BJP’s poaching jab on X

Union Coal Minister and BJP State president G Kishan Reddy’s attempt to take a potshot on ‘X’ at Congress MP Rahul Gandhi over the defections of MLAs ...

scrzonerpfrescues100childrenunder‘operationnanhefarishte’injune

SCR zone RPF rescues 100 children under ‘Operation Nanhe Farishte’ in June

During the month of June, the Railway Protection Force (RPF) of the South Central Railway (SCR) zone rescued 100 children including 14 girls who were ...

yogiadityanathgivessterninstructionstoministersaheadofbypollsinuttarpradesh

Yogi Adityanath gives stern instructions to ministers ahead of bypolls in Uttar Pradesh

Following a disappointing performance in the Lok Sabha elections, Chief Minister Yogi Adityanath convened a meeting with his cabinet ministers in Luck...

hyderabadmanarrestedfordancingwithswordinabaraat

Hyderabad man arrested for dancing with sword in a baraat

The Santoshnagar police arrested a man for dancing with a sword at a baraat. The police seized the sword from him.The arrested person identified as Ab...

bibikaalamprocessionmarks10thmuharraminhyderabad

Bibi-ka-Alam procession marks 10th Muharram in Hyderabad

Mourning and solemnity marked Youm-e-Ashoora, the 10th day of Muharram in the city on Wednesday. The highlight of the day was the annual Bibi-ka-Alam ...

keralacopdragspetrolpumpstafferonbonnetfor1kmwontpayforfuel

Kerala Cop Drags Petrol Pump Staffer On Bonnet For 1km 'Won't Pay For Fuel'

A police officer in Kerala's Kannur district was suspended on Tuesday for attempting to mow down a petrol pump employee after being asked to make paym...

mansuffersheartattackandcollapsesatdelhiairportdoctorrescuesbygivingcpr

Man suffers Heart Attack and Collapses At Delhi Airport, doctor rescues by giving CPR

In a heroic act, a woman saved an elderly man who suffered heart attack at Delhi Airport on Wednesday. The video of the woman giving CPR to the elderl...

karnatakabusdriverhitsbullockcartfrombehindinjuringfarmersmakingreelwhiledriving

Karnataka Bus Driver Hits Bullock Cart From Behind Injuring Farmers 'Making Reel While Driving'

A government bus driver hit a bullock cart killing two bulls on the spot and severely injuring the farmers on it while making a reel in Karnataka’s Hu...

customerfindswormsinsidehighproteinbuttermilk‘stopbuyingproductsfromamul’

Customer Finds Worms Inside High Protein Buttermilk ‘Stop Buying Products From Amul’

Ordering dairy products has become risky nowadays, as worms and centipedes are found in the products delivered online. In another incident, worms were...

hindutvamobattackschristianprayermeetindehradunwhereisyoursindoor

Hindutva mob attacks Christian prayer meet in Dehradun 'Where is your sindoor'

A Christian prayer meeting was attacked by a Hindutva mob in Uttarakhand’s Dehradun district.The prayer meeting was being held in a residence on July ...

mansavesmynabyperformingcprinkeralabirdfliesaftertimelycare

Man Saves Myna By Performing CPR In Kerala, Bird Flies After Timely Care

A heartwarming video of a myna being rescued from the mouth of death has surfaced online. It showed a man spotting the bird fallen unconscious on the ...

Displaying 26071 - 26100 of 123476 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand