logo
 
Displaying 93121 - 93150 of 123912 total results
metofficewarnsveryheavyrainfallingangeticwestbengal

MeT office warns veryheavy rainfall in Gangetic West Bengal

The cyclonic storm Titli has weakened into deep depression over Odisha and has moved east-northeastwards.Director general of IMD K J Ramesh said, the ...

venkaiahnaidutovisitallahabadtoday

Venkaiah Naidu to visit Allahabad today

Vice President M. Venkaiah Naidu will visit Allahabad today to inaugurate the newly built annex of the High Court Building. Beside Chief Justice of th...

thirdphaseofmunicipalelectionsunderwayinjk

Third phase of municipal elections underway in J&K

The third phase of municipal elections is being held in Jammu division today.The polling begins 6 this morning and will conclude at 4 in the evening i...

pmmodididittoo:kcrspartycountersamitshahonearlypolls

PM Modi did it too: KCR's party counters Amit Shah on early polls

HYDERABAD: The Telangana Rashtra Samithi (TRS) today gave BJP president Amit Shah a history lesson in response to his comments attacking their party c...

ailingcmmanoharparrikarmeetsgoacabinetataiimsmayreturnduringdiwali

Ailing CM Manohar Parrikar meets Goa cabinet at AIIMS, may return during Diwali

Panaji: Goa Chief Minister Manohar Parrikar, who is undergoing treatment at AIIMS, on Friday met the Goa BJP core committee in New Delhi to review the...

indiasettobeelectedtounhumanrightscouncilforthreeyears

India set to be elected to UN Human Rights Council for three years

United Nations: India appears set to be elected to the United Nations's top human rights body in the Asia-Pacific category for a period of three years...

ripwomenenteringsabarimalatempleinhalfsayskeralaactorkollamthulasi

Rip women entering Sabarimala temple in half, says Kerala Actor Kollam Thulasi

Kollam: Actor Kollam Thulasi made a bizarre statement on Friday saying women who come to enter the Sabarimala temple in Kerala, the revered shrine of ...

4retiredjudgestoholdpublichearingsof#metoocasessaysmanekagandhi

4 retired judges to hold public hearings of #MeToo cases,says Maneka Gandhi

New Delhi: With the #MeToo movement intensifying in the country with every passing day, Union Minister Maneka Gandhi on Friday said that four retired ...

on#metoorahulgandhisaystruthneedstobetoldloudandclear

On #MeToo, Rahul Gandhi says, Truth needs to be told loud and clear

Congress president Rahul Gandhi Friday came out in support of the #MeToo movement, saying it was about time that everyone learns to treat women with r...

keralahighcourtdismisseshinduoutfit’spleaforallowingmuslimwomeninmosques

Kerala High Court dismisses Hindu outfit’s plea for allowing Muslim women in mosques

The Kerala High Court Thursday dismissed a PIL filed by a Hindu group seeking entry of Muslim women into mosques for offering prayers. A division benc...

governmenthikescustomsdutyonmoreitemstoreinincurrentaccountdeficit

Government hikes customs duty on more items to rein in current account deficit

New Delhi: The government on Thursday increased customs duty on a host of items, including telecommunication equipment, to 20% from the existing 10%, ...

#metoomovement:smritiiraniputsonusonmjakbartorespondtoharassmentcharges

#MeToo movement: Smriti Irani puts onus on MJ Akbar to respond to harassment charges

Union minister Smriti Irani on Thursday put the onus on minister of state for external affairs MJ Akbar to respond to allegations of sexual harassment...

pmmodisayscongressdrovewedgebetweentelanganaandap

PM Modi says Congress drove wedge between Telangana and AP

Hyderabad: Prime Minister Narendra Modi on Thursday alleged that the Congress made the people of Telangana state and Andhra Pradesh states enemies.Add...

globalinternetshutdownlikelyovernext48hours:report

Global internet shutdown likely over next 48 hours: Report

NEW DELHI: Internet users across the globe may experience widespread network failures as the key domain servers are slated to undergo routine maintena...

48casesofswinefludetectsinjust10daysofoctober

48 cases of swine flu detects in just 10 days of October

As per health department records, a spurt in H1N1 cases began in mid-September. Since then, 79 cases have been detected among which, 48 confirmed case...

japaneseteammeetsghmcofficialsinhyderabad

Japanese team meets GHMC officials in Hyderabad

A Japanese delegation from Ishikawa-India Association met officials of the Greater Hyderabad Municipal Corporation (GHMC) and showcased a few technolo...

rtcwillbegovtbodyifcongresswins:uttamkumarreddy

RTC will be govt body if Congress wins: Uttam Kumar Reddy

The Congress on Thursday claimed that the TRS, if voted back to power, would shut down the Telangana State Road Transport Corporation, said TPCC presi...

padmininarsimhareddyjoinsbjpthenquits

Padmini Narsimha Reddy joins BJP, then quits

It was a short-lived joy for the BJP when Padmini Narsimha Reddy, wife of Telangana Congress manifesto committee chairman and former Deputy Chief Mini...

bjpshopesofmakinginroadsintotelanganawillremainadream:ktramarao

BJP's hopes of making inroads into Telangana will remain a dream: KT Rama Rao

 IT and Industries Minister KT Rama Rao on Thursday, launching a scathing attack on BJP and its national president Amit Shah, said the party’s ho...

ectoholdmeetingwithtsofficialstoday

EC to hold meeting with TS officials today

The Election Commission of India will hold a crucial meeting on Friday with top officials of the State government in connection with the security arra...

naxalgunneddownbysecurityforcesinchhattisgarh

Naxal gunned down by security forces in Chhattisgarh

Raipur: One naxal was gunned down in an encounter with security forces in Sukma district of Chhattisgarh, police said Friday.The gunbattle took place ...

govthikesimportdutyoncertaincommunicationitemsupto20%

Govt hikes import duty on certain communication items up to 20%

The government has hiked import duty on certain communication items, including base stations, to up to 20 per cent. The Central Board of Indirect Taxe...

apcmchandrababunaiduappealsto15thfinancecommissiontoaccordspecialcategorystatustostate

AP CM Chandrababu Naidu appeals to 15th Finance Commission to accord special category status to state

The Andhra Pradesh Chief Minister N Chandrababu Naidu has appealed to 15th Finance Commission to accord special category status to the state. The chie...

statesutsreleaseover900prisonersaspartofcommemorationofthe150thbirthanniversaryofmahatmagandhi

States, UTs release over 900 prisoners as part of commemoration of the 150th Birth Anniversary of Mahatma Gandhi

The States and Union Territories, UTs have released over 900 prisoners as part of commemoration of the 150th Birth Anniversary of Mahatma Gandhi. ...

fivekilledafterunderconstructionmallcollapsedinmexico

Five killed after under construction mall collapsed in Mexico

In Mexico, at least five people were killed after the collapse of a shopping mall under construction in the northern city of Monterrey.  The civi...

malaysiangovernmentdecidestoabolishcapitalpunishment

Malaysian government decides to abolish capital punishment

In Malaysia, the cabinet yesterday decided to abolish the death penalty. Communications and multimedia Minister Gobind Singh Deo said, the government ...

presidentarifalvisackshighcourtjudgeinpakistan

President Arif Alvi sacks high court judge in Pakistan

In Pakistan, President Arif Alvi sacked a high court judge yesterday after a high-level constitutional body recommended his removal for making a scath...

threedaysilverjubileecelebrationsofnhrcbegin

Three-day Silver Jubilee celebrations of NHRC begin

The three-day Silver Jubilee celebrations of the National Human Rights Commission (NHRC) will begin today to mark the occasion. The Commission is comp...

centreapprovesspecialpackageforfootwearandleathersector

Centre approves special package for footwear and leather sector

The Central Government has approved a special package for employment generation in leather and footwear sector. Centre has approved four projects wort...

nirmalasitharamanholdstalkswithherfrenchcounterpartflorenceparly

Nirmala Sitharaman holds talks with her French counterpart Florence Parly

Defence Minister Nirmala Sitharaman today held wide-ranging talks with her French counterpart Florence Parly in Paris on ways to deepen strategic and ...

Displaying 93121 - 93150 of 123912 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket teams will reach the IPL 2026 finals?

SRH and PBKS
RCB and RR
MI and DC