logo
 
Displaying 91051 - 91080 of 121853 total results
hyderabad:21yrsoldengineeringfinalyearstudentdiedinaroadaccident

Hyderabad: 21yrs old Engineering final year student died in a road accident

Hyderabad: 21yrs old Engineering final year student of Yakuthpura by name Md.Ishaq died in a road accident at Maharashtra Nagpur highway today.....Ano...

restrictionsontrafficinamberpet

Restrictions on traffic in Amberpet

In view of construction works on a four-lane flyover at Amberpet on NH-163, from Golnaka Shalem Church to Mukkaram Hotel in Amberpet, traffic police h...

dasarafestival:tsrtctosetuptemporaryoriginatingpointsforbusesfromoct16

Dasara festival:TSRTC to set up temporary originating points for buses from Oct 16

To ease traffic congestion at Mahatma Gandhi Bus Station (MGBS) during the Dasara festive rush, traffic and TSRTC officials have decided to set up tem...

tsassemblyelections:specialsecurityforextremisthitareas

TS Assembly elections: Special security for extremist-hit areas

Special security forces will be deployed in extremist-affected areas for smooth conduct of State Assembly elections besides taking other security meas...

uspastorandrewbrunsonleavesturkey

US pastor Andrew Brunson leaves Turkey

US pastor Andrew Brunson, who was convicted on terror charges, has left Turkey after release by a court. The evangelical pastor from North Carolina an...

atleast41peopledeadinugandalandslide

At least 41 people dead in Uganda landslide

In Uganda, at least 41 people were killed after a river burst its banks in eastern part of the country, resulting in rocks and muds barrelling into ho...

niacourtinmumbaihasorderedattachmentof4propertiesofzakirnaik

NIA court in Mumbai has ordered attachment of 4 properties of Zakir Naik

Mumbai’s special NIA court has ordered attachment of four properties belonging to absconding Islamic preacher Zakir Naik. During a hearing, the court ...

oneterroristkilledinencounterwithsecurityforcespulwamadistrict

One terrorist killed in encounter with security forces Pulwama district

In Jammu and Kashmir, one terrorist was killed in an encounter with security forces Pulwama district this morning. The identity of the terrorist is ye...

indiaandazerbaijanagreetoenhancebilateraltraderelations

India and Azerbaijan agree to enhance bilateral trade relations

India and Azerbaijan have agreed to take measures to enhance bilateral trade relations. The two countries signed protocol on trade and economic, scien...

defenceministernirmalasitharamancallsuponfrenchdefenceindustrytoexpandtheirmanufacturingundermakeinindiainitiative

Defence Minister Nirmala Sitharaman calls upon French Defence industry to expand their manufacturing under Make in India initiative

Defence Minister Nirmala Sitharaman held wide-ranging talks with her French counterpart Florence Parly in Paris yesterday.The talks were held under th...

govtassurescountrynottofaceanyinternetshutdowninviewofreportsofglobaloutage

Govt assures, Country not to face any internet shutdown in view of reports of Global outage

A top government cyber security official has said that India will not face any internet shutdown, quashing fears of an internet blackout in the countr...

metofficewarnsveryheavyrainfallingangeticwestbengal

MeT office warns veryheavy rainfall in Gangetic West Bengal

The cyclonic storm Titli has weakened into deep depression over Odisha and has moved east-northeastwards.Director general of IMD K J Ramesh said, the ...

venkaiahnaidutovisitallahabadtoday

Venkaiah Naidu to visit Allahabad today

Vice President M. Venkaiah Naidu will visit Allahabad today to inaugurate the newly built annex of the High Court Building. Beside Chief Justice of th...

thirdphaseofmunicipalelectionsunderwayinjk

Third phase of municipal elections underway in J&K

The third phase of municipal elections is being held in Jammu division today.The polling begins 6 this morning and will conclude at 4 in the evening i...

pmmodididittoo:kcrspartycountersamitshahonearlypolls

PM Modi did it too: KCR's party counters Amit Shah on early polls

HYDERABAD: The Telangana Rashtra Samithi (TRS) today gave BJP president Amit Shah a history lesson in response to his comments attacking their party c...

ailingcmmanoharparrikarmeetsgoacabinetataiimsmayreturnduringdiwali

Ailing CM Manohar Parrikar meets Goa cabinet at AIIMS, may return during Diwali

Panaji: Goa Chief Minister Manohar Parrikar, who is undergoing treatment at AIIMS, on Friday met the Goa BJP core committee in New Delhi to review the...

indiasettobeelectedtounhumanrightscouncilforthreeyears

India set to be elected to UN Human Rights Council for three years

United Nations: India appears set to be elected to the United Nations's top human rights body in the Asia-Pacific category for a period of three years...

ripwomenenteringsabarimalatempleinhalfsayskeralaactorkollamthulasi

Rip women entering Sabarimala temple in half, says Kerala Actor Kollam Thulasi

Kollam: Actor Kollam Thulasi made a bizarre statement on Friday saying women who come to enter the Sabarimala temple in Kerala, the revered shrine of ...

4retiredjudgestoholdpublichearingsof#metoocasessaysmanekagandhi

4 retired judges to hold public hearings of #MeToo cases,says Maneka Gandhi

New Delhi: With the #MeToo movement intensifying in the country with every passing day, Union Minister Maneka Gandhi on Friday said that four retired ...

on#metoorahulgandhisaystruthneedstobetoldloudandclear

On #MeToo, Rahul Gandhi says, Truth needs to be told loud and clear

Congress president Rahul Gandhi Friday came out in support of the #MeToo movement, saying it was about time that everyone learns to treat women with r...

keralahighcourtdismisseshinduoutfit’spleaforallowingmuslimwomeninmosques

Kerala High Court dismisses Hindu outfit’s plea for allowing Muslim women in mosques

The Kerala High Court Thursday dismissed a PIL filed by a Hindu group seeking entry of Muslim women into mosques for offering prayers. A division benc...

governmenthikescustomsdutyonmoreitemstoreinincurrentaccountdeficit

Government hikes customs duty on more items to rein in current account deficit

New Delhi: The government on Thursday increased customs duty on a host of items, including telecommunication equipment, to 20% from the existing 10%, ...

#metoomovement:smritiiraniputsonusonmjakbartorespondtoharassmentcharges

#MeToo movement: Smriti Irani puts onus on MJ Akbar to respond to harassment charges

Union minister Smriti Irani on Thursday put the onus on minister of state for external affairs MJ Akbar to respond to allegations of sexual harassment...

pmmodisayscongressdrovewedgebetweentelanganaandap

PM Modi says Congress drove wedge between Telangana and AP

Hyderabad: Prime Minister Narendra Modi on Thursday alleged that the Congress made the people of Telangana state and Andhra Pradesh states enemies.Add...

globalinternetshutdownlikelyovernext48hours:report

Global internet shutdown likely over next 48 hours: Report

NEW DELHI: Internet users across the globe may experience widespread network failures as the key domain servers are slated to undergo routine maintena...

48casesofswinefludetectsinjust10daysofoctober

48 cases of swine flu detects in just 10 days of October

As per health department records, a spurt in H1N1 cases began in mid-September. Since then, 79 cases have been detected among which, 48 confirmed case...

japaneseteammeetsghmcofficialsinhyderabad

Japanese team meets GHMC officials in Hyderabad

A Japanese delegation from Ishikawa-India Association met officials of the Greater Hyderabad Municipal Corporation (GHMC) and showcased a few technolo...

rtcwillbegovtbodyifcongresswins:uttamkumarreddy

RTC will be govt body if Congress wins: Uttam Kumar Reddy

The Congress on Thursday claimed that the TRS, if voted back to power, would shut down the Telangana State Road Transport Corporation, said TPCC presi...

padmininarsimhareddyjoinsbjpthenquits

Padmini Narsimha Reddy joins BJP, then quits

It was a short-lived joy for the BJP when Padmini Narsimha Reddy, wife of Telangana Congress manifesto committee chairman and former Deputy Chief Mini...

bjpshopesofmakinginroadsintotelanganawillremainadream:ktramarao

BJP's hopes of making inroads into Telangana will remain a dream: KT Rama Rao

 IT and Industries Minister KT Rama Rao on Thursday, launching a scathing attack on BJP and its national president Amit Shah, said the party’s ho...

Displaying 91051 - 91080 of 121853 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Should there be an India-Pakistan cricket match or not?

Yes, it should be.
Shouldn't be.
Can't Say