logo
 
Displaying 64381 - 64410 of 123932 total results
indianathleticslegendflyingsikhmilkhasinghpassesawayat91ofcovid19

Indian Athletics Legend 'Flying Sikh' Milkha Singh Passes Away at 91 of Covid-19

Milkha Singh, one of the biggest names in Indian sport and the country’s first track and field superstar, passed away after a month-long battle with C...

statecabinettomeetonjune19todecideonlockdown

State cabinet to meet on June 19, to decide on lock down

Hyderabad: The cabinet meeting chaired by Telangana Chief Minister K Chandrasekhar Rao will be held on Saturday. The Cabinet will meet at 2 p.m on Jun...

11montholdflowninfromdubaiwithmothersashesaftershelosesbattletocovid

11-month-old Flown in from Dubai With Mother's Ashes After She Loses Battle to Covid

An 11-month-old child on Thursday arrived in India from Dubai, carrying his mother's ashes, who died due to Covid-19.He was received at the Trichy Int...

42magnitudeearthquakehitsgujaratskutch

4.2 magnitude earthquake hits Gujarat's Kutch

An earthquake of magnitude 4.2 on the Richter Scale was felt in Gujarat's Kutch on Friday. The quake, which occurred at 3.45 p.m., had its epicentre n...

covidvaccinationlowerschancesofhospitalisationby7580percentsaysgovt

Covid vaccination lowers chances of hospitalisation by 75-80 per cent, says Govt

NEW DELHI: Studies have shown that after COVID-19 vaccination the chances of hospitalization among healthcare workers (HCWs) reduce by 75-80 per cent ...

plumberdiesathyderabadairportinvestigationunderway

Plumber dies at Hyderabad airport, investigation underway

A plumber tasked with cleaning a drainage line at the arrival area of Rajiv Gandhi International Airport in Hyderabad died late Thursday evening. The ...

shimlamansentencedtolifelongjailtermforrapeandmurderofminor:gudiyacase

Shimla Man Sentenced To Life-long Jail Term For Rape And Murder Of Minor: Gudiya Case

Almost three months after 28-year-old Anil Kumar, alias Neelu, a woodcutter, was convicted in the rape and murder case of 16-year-old school girl at K...

sbicustomers:knowhowtocheckaccountbalancethroughmissedcallorsms

SBI Customers: Know How to Check Account Balance through Missed call or SMS

Banking has become easy with internet, and you can now log in to your net banking account and perform various actions like checking balance, transfer,...

iraniansvotingtoelectpresidenttoday

Iranians Voting To Elect President Today

Iranians are voting to elect a new president, with four candidates in fray. Opinion polls suggest Ebrahim Raisi, who heads the judiciary, is the clear...

pmmodisaysgovtcommittedtoprovidecovid19vaccinetoeveryonefreeofcost

PM Modi Says Govt Committed to Provide COVID-19 Vaccine to Everyone Free of Cost

Prime Minister Narendra Modi has said that the Government is committed to provide free of cost Covid-19 vaccine to everyone. He said, vaccination cove...

pmmodilaunchescustomizedcrashcourseprogrammeforcovid19frontlineworkers

PM Modi Launches Customized Crash Course Programme for COVID-19 Frontline Workers

Prime Minister Narendra Modi today launched a Customized Crash Course programme for Covid-19 Frontline workers. With the launch, programme in 111 trai...

newzealandannouncesvaxrolloutplanforgeneralpopulation

New Zealand announces vax rollout plan for general population

Wellington: New Zealand citizens aged over 60 will be offered vaccination from July 28 and those aged over 55 from August 11, Prime Minister Jacinda A...

aatmanirbharpackageneedsarelook:ktramarao

Aatmanirbhar package needs a relook: K T Rama Rao

IT and Industries Minister KT Rama Rao on Thursday picked holes in the implementation of the much-touted Aatmanirbhar relief package and sought an imm...

nehruzoocelebratesworldcrocodileday

Nehru Zoo celebrates World Crocodile Day

The Nehru Zoological Park celebrated World Crocodile Day on Thursday to raise awareness about the need to save these endangered species from extinctio...

ghmccouncilmeetonjune29

GHMC council meet on June 29

The first meeting of the Greater Hyderabad Municipal Corporation (GHMC) new council will be held on June 29 virtually. The budget of Rs 5,600 crore fo...

cjiforinternationalarbitrationcentreinhyderabad

CJI for International Arbitration Centre in Hyderabad

Chief Justice of India NV Ramana on Thursday said he has sought the help of his counterpart in Singapore for establishing an International Arbitration...

telanganahighcourtdirectswakfboardtofilefreshreport

Telangana High Court directs Wakf Board to file fresh report

A two-judge panel of Telangana High Court comprising Chief Justice Hima Kohli and Justice B Vijaysen Reddy enlarged time to Wakf Board and directed fi...

rachakondacommissionermaheshbhagwatacceptsgreenindiachallenge

Rachakonda Commissioner Mahesh Bhagwat accepts Green India Challenge

On the occasion of his birthday, Rachakonda Police Commissioner Mahesh Bhagwat accepted the Green India Challenge of Rajyasabha MP J Santosh Kumar, an...

homeministryoperationalisesnationalhelplineforpreventingfinanciallossduetocyberfraud

Home Ministry operationalises National Helpline for preventing financial loss due to cyber fraud

Home Ministry has operationalised the national Helpline 155260 and Reporting Platform for preventing financial loss due to cyber fraud. The National H...

govtaimstoreduceroadaccidentdeathsby50percentby2024:nitingadkari

Govt aims to reduce road accident deaths by 50 percent by 2024: Nitin Gadkari

Minister for Road Transport and Highways Nitin Gadkari yesterday said, Government’s target is to reduce road accident deaths by 50 percent by 2024.&nb...

governmentnotinfavourofbanninganydigitalsocialplatformbytheyhavetofollowlaw:itminister

Government not in favour of banning any digital social platform by they have to follow law: IT Minister

Information Technology Minister Ravi Shankar Prasad emphasised that government is not in favour of banning any platform at the same time, they have to...

chinasendsastronautstoitsnewspacestation:tiangong

China sends astronauts to its new space station: Tiangong

China has successfully sent its first astronauts to the country’s Tiangong space station onboard the Shenzhou-12 – its first manned spacecraft since 2...

icelandisonthetopoftheglobalpeaceindex2021

Iceland is on the top of the Global Peace Index 2021

Globally, Iceland was on the top of the peace index followed by New Zealand, Denmark and Portugal. Out of the 10 most peaceful countries in the world,...

ussupremecourtrejectschallengebyrepublicanledstatesofformerpresidentbarackobamashealthcareoverhaul

US Supreme Court rejects challenge by Republican-led states of former President Barack Obama's healthcare overhaul

The US Supreme Court has rejected a challenge by Republican-led states to former President Barack Obama's healthcare overhaul. Despite the court'...

lgmanojsinhadirectsforestablishmentofyouthclubsineverypanchayatacrossjk

LG Manoj Sinha directs for establishment of Youth Clubs in every Panchayat across J&K

In the Union Territory of Jammu and Kashmir, Lieutenant Governor Manoj Sinha has directed for the establishment of Youth Clubs in every Panchayat acro...

maharashtragovttofilereviewpetitioninsupremecourtonmarathareservationissue

Maharashtra govt to file review petition in Supreme Court on Maratha Reservation issue

Maharashtra Government has decided to file a review petition in the Supreme Court on the Maratha Reservation issue. State Minister and Chairman of sub...

rajnathsinghdedicates12roadprojectsofborderroadorganisationtonation

Rajnath Singh dedicates 12 road projects of Border Road Organisation to Nation

Defence Minister Rajnath Singh on Thursday dedicated 12 roads to the nation, built by Border Roads Organisation in Northern and Eastern border areas. ...

expectcheaperelectricitybillsprepaidoptionwithnewsmartmeters

Expect cheaper electricity bills, prepaid option with new smart meters

HYDERABAD:  Soon consumers in Greater Hyderabad limits will be able to get accurate power bills, view real-time energy usage, and even be ab...

privateagency2labsbookedforfakecovidreportsduringkumbh

Private agency, 2 labs booked for fake Covid reports during Kumbh

The Uttarakhand Police Thursday lodged an FIR against a private agency and two laboratories for allegedly issuing fake rapid antigen test reports duri...

orchardistsfrommadhyapradeshhiresecuritytopreventtheftofrarecostlymiyazakimangoes

Orchardists from Madhya Pradesh hire security to prevent theft of rare & costly Miyazaki Mangoes

Mango is the national fruit of India for several reasons, one being the myriad varieties that grow here. Adding to the list of Malihabadi Dasheris fro...

Displaying 64381 - 64410 of 123932 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket teams will reach the IPL 2026 finals?

SRH and PBKS
RCB and RR
MI and DC