logo
 
Displaying 49351 - 49380 of 123577 total results
southkoreascramblesfighterjetsafterdetecting180northkoreanwarplanes

South Korea scrambles fighter jets after detecting 180 North Korean warplanes

Seoul: Tensions in the Korean Peninsula are peaking as South Korea scrambled fighter jets after detecting about 180 North Korean warplanes flying nort...

germanchancellorolafscholzvisitschina

German Chancellor Olaf Scholz visits China

Beijing: Chinese President Xi Jinping on Friday called on Germany to follow a “positive China policy” during a meeting with the visiting German Chance...

nestawayhasplanstodoubleportfolioinhyderabadaswfhtrendends

Nestaway has plans to double portfolio in Hyderabad, As WFH trend ends

Finding a house on rent is a time consuming process from the tenants point of view. It is also fraught with maintenance and rent collection issues for...

whatsapplaunchescommunitiesfeature:whatisithowtouseotherdetails;techtips

WhatsApp launches Communities feature: What is it, how to use, other details ; Tech Tips

WhatsApp has finally announced the global launch of its much-awaited Communities feature. Popular messaging platform has started rolling out the featu...

tscmkcrtocampaigningujarathimachalpradeshassemblyelections

TS CM KCR to campaign in Gujarat, Himachal Pradesh Assembly elections

TRS (now BRS) President and Chief Minister K Chandrashekhar Rao is all set to launch a nation-wide movement against the BJP and expose its conspiracie...

shivsenaleadersudhirsurishotdeadoutsidetempleinamritsar;accusedarrested

Shiv Sena leader Sudhir Suri shot dead outside temple in Amritsar; accused arrested

AMRITSAR/CHANDIGARH: Punjab politician Sudhir Suri, a leader of Shiv Sena (Taksali), was on Friday shot dead by a shopkeeper while he was sitting on a...

karnatakapoliceintroduceefirsystemfortheftorlossofvehicles

Karnataka Police introduce e-FIR system for theft or loss of vehicles

The Karnataka Police have introduced a full-fledged electronic first information report (FIR) filing system for vehicle thefts through linkages to the...

mla’spoaching:sctohearpleabyaccusedchallengingarreston7nov

MLA’s poaching: SC to hear plea by accused challenging arrest on 7 Nov

The Supreme Court has agreed to examine on Monday a plea by three persons arrested by the Telangana police for allegedly trying to poach MLAs of the r...

gujaratassemblypoll2022:congressnamed43candidatesinfirstlist

Gujarat Assembly Poll 2022: Congress named 43 candidates in first list

Congress on Friday evening released the first list of 43 candidates for Gujarat Assembly elections. The list came after party president Mallikarj...

iknewiwillbeattackedsaysimrankhaninhisfirstpressconference

I knew I will be attacked, says Imran Khan in his first press conference

Former Pakistan Prime Minister and PTI (Pakistan Tehreek-e-Insaf) leader Imran Khan on Friday addressed a press conference for the first time after be...

imrankhanvowstocontinueprotestmarchafterattackonhim

Imran Khan vows to continue protest march after attack on him

Islamabad: Imran Khan is stable after an attempt on his life and the former Pakistan prime minister is determined to continue his political struggle t...

foreignsecretaryvinaykwatrameetsunsecretarygeneralantonioguterres

Foreign Secretary Vinay Kwatra meets UN Secretary General Antonio Guterres

United Nations: Foreign Secretary Vinay Kwatra met top UN leaders, including Secretary-General Antonio Guterres here and discussed “issues of pressing...

motherdaughterduokilledasbouldertriggeredbylandslidehitshouseinjk

Mother-daughter duo killed as boulder triggered by landslide hits house in J&K

Jammu: A woman and her minor daughter died on Friday after a big boulder following a landslide hit their house in Jammu and Kashmir's Poonch district,...

eightfetusesfoundin21dayoldbaby

Eight fetuses found in 21-day-old baby

Ranchi: In a rare case, as many as eight fetuses were found in the abdomen of a 21-day-old baby during an operation in a private hospital here, doctor...

muskbeginslayingofftwitteremployeesshutsoffices‘temporarily’

Musk begins laying off Twitter employees, shuts offices ‘temporarily’

San Francisco: Twitter has notified employees that it will be “reducing its global workforce” on Friday, as its new CEO Elon Musk aims to cut roughly ...

catshowinhyderabadonnovember6

Cat show in Hyderabad on November 6

Feline Club of India, an organisation formed by cat enthusiasts four years ago, is hosting a Cat Competition Show in Hyderabad this Sunday, November 6...

twoyoungsterskilledafterbikecrashesintoroadmedianatnallakunta

Two youngsters killed after bike crashes into road median at Nallakunta

Two youngsters died on the spot after the bike they were riding crashed into the road median at Nallakunta in the wee hours of Friday.The victims, age...

dharaniportalregisters281lakhgiftdeeds

Dharani portal registers 2.81 lakh gift deeds

On Wednesday, the Dharani Portal registered two years of operation, registering 2.81 lakh Gift Deeds, succession rights for 1.80 lakh persons and 9.16...

exitpollspredictthumpingwinfortrsinmunugode

Exit polls predict thumping win for TRS in Munugode

As polling stations saw the last of voters for the Munugode bypoll, many exit polls have been released, predicting a thumping majority for the ruling ...

rahulgandhiinteractswithlocalcommunitiesduringhisbharatjodoyatrainsangareddy

Rahul Gandhi interacts with local communities during his Bharat Jodo Yatra in Sangareddy

Congress leader and MP Rahul Gandhi interacted with local communities during his Bharat Jodo Yatra in Sangareddy Assembly Constituency on Thursday mor...

ktrthankstrspartycadreformunugodebypollefforts

KTR thanks TRS party cadre for Munugode bypoll efforts

TRS (now BRS) working president KT Rama Rao has thanked each and every leader, activists and the cadre of the party for putting their best efforts ove...

scrannouncespermanentaugmentationofcoachesinvarioustrains

SCR announces permanent augmentation of coaches in various trains

To provide additional travelling facility for waiting list passengers during the festival season, the South Central Railway (SCR) has announced perman...

irequestprimeministermoditostoptheseconspiraciesotherwiseyournamewillremaintaintedinthecountry’shistory:cmkcr

I request Prime Minister Modi to stop these conspiracies, otherwise your name will remain tainted in the country’s history: CM KCR

Chief Minister K Chandrashekhar Rao, who put in public domain what he called clear evidence of a well organized crime, also made a sincere appeal to P...

driverfleeswithatmcashvehicleinhyderabad

Driver flees with ATM cash vehicle in Hyderabad

The driver of a cash management company allegedly fled with the vehicle containing cash of Rs.31 lakh at Rajendranagar on Thursday.However, the police...

andhrapradeshchiefsecretarysameersharmahospitalisedagain

Andhra Pradesh Chief Secretary Sameer Sharma hospitalised again

Amaravati: Chief Secretary of Andhra Pradesh Government Sameer Sharma was hospitalised on Thursday after he fell ill during a review meeting at the Se...

11personskilled1injuredafteransuvcollidedwithbusinbetulmp

11 persons killed, 1 injured after an SUV collided with bus in Betul, MP

Betul: As many as 11 persons were killed and one person sustained injuries after an SUV they were travelling in collided with a bus near Jhallar polic...

usriskslosingtalentedh1bvisaholderstocanada:study

US risks losing talented H1-B visa holders to Canada: Study

New Delhi: The US risks losing talented foreigners, particularly those married to other skilled professionals, to Canada, which grants work authorisat...

15theditionofurbanmobilityindiaconferenceexpotoopeninkochitoday

15th edition of Urban Mobility India Conference & Expo to open in Kochi today

Kochi: The 15th edition of the Urban Mobility India Conference and Expo organised by the Ministry of Housing and Urban Affairs will open in Kochi toda...

benjaminnetanyahucomesbacktopowerinisrael

Benjamin Netanyahu comes back to power in Israel

Tel Aviv: Former Israeli Prime Minister Benjamin Netanyahu has made a stunning come back to power as his Likud party and its far-right and religious a...

sixgrainvesselsleaveukrainianportsafterrussiaresumesparticipationinunbrokereddeal

Six-grain vessels leave Ukrainian ports after Russia resumes participation in UN-brokered deal

Six-grain vessels left Ukrainian ports on Thursday after Russia resumed its participation in the UN-brokered deal which allows grain exports through t...

Displaying 49351 - 49380 of 123577 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand