logo
 
Displaying 46201 - 46230 of 120423 total results
tscmkcrtocampaigningujarathimachalpradeshassemblyelections

TS CM KCR to campaign in Gujarat, Himachal Pradesh Assembly elections

TRS (now BRS) President and Chief Minister K Chandrashekhar Rao is all set to launch a nation-wide movement against the BJP and expose its conspiracie...

shivsenaleadersudhirsurishotdeadoutsidetempleinamritsar;accusedarrested

Shiv Sena leader Sudhir Suri shot dead outside temple in Amritsar; accused arrested

AMRITSAR/CHANDIGARH: Punjab politician Sudhir Suri, a leader of Shiv Sena (Taksali), was on Friday shot dead by a shopkeeper while he was sitting on a...

karnatakapoliceintroduceefirsystemfortheftorlossofvehicles

Karnataka Police introduce e-FIR system for theft or loss of vehicles

The Karnataka Police have introduced a full-fledged electronic first information report (FIR) filing system for vehicle thefts through linkages to the...

mla’spoaching:sctohearpleabyaccusedchallengingarreston7nov

MLA’s poaching: SC to hear plea by accused challenging arrest on 7 Nov

The Supreme Court has agreed to examine on Monday a plea by three persons arrested by the Telangana police for allegedly trying to poach MLAs of the r...

gujaratassemblypoll2022:congressnamed43candidatesinfirstlist

Gujarat Assembly Poll 2022: Congress named 43 candidates in first list

Congress on Friday evening released the first list of 43 candidates for Gujarat Assembly elections. The list came after party president Mallikarj...

iknewiwillbeattackedsaysimrankhaninhisfirstpressconference

I knew I will be attacked, says Imran Khan in his first press conference

Former Pakistan Prime Minister and PTI (Pakistan Tehreek-e-Insaf) leader Imran Khan on Friday addressed a press conference for the first time after be...

imrankhanvowstocontinueprotestmarchafterattackonhim

Imran Khan vows to continue protest march after attack on him

Islamabad: Imran Khan is stable after an attempt on his life and the former Pakistan prime minister is determined to continue his political struggle t...

foreignsecretaryvinaykwatrameetsunsecretarygeneralantonioguterres

Foreign Secretary Vinay Kwatra meets UN Secretary General Antonio Guterres

United Nations: Foreign Secretary Vinay Kwatra met top UN leaders, including Secretary-General Antonio Guterres here and discussed “issues of pressing...

motherdaughterduokilledasbouldertriggeredbylandslidehitshouseinjk

Mother-daughter duo killed as boulder triggered by landslide hits house in J&K

Jammu: A woman and her minor daughter died on Friday after a big boulder following a landslide hit their house in Jammu and Kashmir's Poonch district,...

eightfetusesfoundin21dayoldbaby

Eight fetuses found in 21-day-old baby

Ranchi: In a rare case, as many as eight fetuses were found in the abdomen of a 21-day-old baby during an operation in a private hospital here, doctor...

muskbeginslayingofftwitteremployeesshutsoffices‘temporarily’

Musk begins laying off Twitter employees, shuts offices ‘temporarily’

San Francisco: Twitter has notified employees that it will be “reducing its global workforce” on Friday, as its new CEO Elon Musk aims to cut roughly ...

catshowinhyderabadonnovember6

Cat show in Hyderabad on November 6

Feline Club of India, an organisation formed by cat enthusiasts four years ago, is hosting a Cat Competition Show in Hyderabad this Sunday, November 6...

twoyoungsterskilledafterbikecrashesintoroadmedianatnallakunta

Two youngsters killed after bike crashes into road median at Nallakunta

Two youngsters died on the spot after the bike they were riding crashed into the road median at Nallakunta in the wee hours of Friday.The victims, age...

dharaniportalregisters281lakhgiftdeeds

Dharani portal registers 2.81 lakh gift deeds

On Wednesday, the Dharani Portal registered two years of operation, registering 2.81 lakh Gift Deeds, succession rights for 1.80 lakh persons and 9.16...

exitpollspredictthumpingwinfortrsinmunugode

Exit polls predict thumping win for TRS in Munugode

As polling stations saw the last of voters for the Munugode bypoll, many exit polls have been released, predicting a thumping majority for the ruling ...

rahulgandhiinteractswithlocalcommunitiesduringhisbharatjodoyatrainsangareddy

Rahul Gandhi interacts with local communities during his Bharat Jodo Yatra in Sangareddy

Congress leader and MP Rahul Gandhi interacted with local communities during his Bharat Jodo Yatra in Sangareddy Assembly Constituency on Thursday mor...

ktrthankstrspartycadreformunugodebypollefforts

KTR thanks TRS party cadre for Munugode bypoll efforts

TRS (now BRS) working president KT Rama Rao has thanked each and every leader, activists and the cadre of the party for putting their best efforts ove...

scrannouncespermanentaugmentationofcoachesinvarioustrains

SCR announces permanent augmentation of coaches in various trains

To provide additional travelling facility for waiting list passengers during the festival season, the South Central Railway (SCR) has announced perman...

irequestprimeministermoditostoptheseconspiraciesotherwiseyournamewillremaintaintedinthecountry’shistory:cmkcr

I request Prime Minister Modi to stop these conspiracies, otherwise your name will remain tainted in the country’s history: CM KCR

Chief Minister K Chandrashekhar Rao, who put in public domain what he called clear evidence of a well organized crime, also made a sincere appeal to P...

driverfleeswithatmcashvehicleinhyderabad

Driver flees with ATM cash vehicle in Hyderabad

The driver of a cash management company allegedly fled with the vehicle containing cash of Rs.31 lakh at Rajendranagar on Thursday.However, the police...

andhrapradeshchiefsecretarysameersharmahospitalisedagain

Andhra Pradesh Chief Secretary Sameer Sharma hospitalised again

Amaravati: Chief Secretary of Andhra Pradesh Government Sameer Sharma was hospitalised on Thursday after he fell ill during a review meeting at the Se...

11personskilled1injuredafteransuvcollidedwithbusinbetulmp

11 persons killed, 1 injured after an SUV collided with bus in Betul, MP

Betul: As many as 11 persons were killed and one person sustained injuries after an SUV they were travelling in collided with a bus near Jhallar polic...

usriskslosingtalentedh1bvisaholderstocanada:study

US risks losing talented H1-B visa holders to Canada: Study

New Delhi: The US risks losing talented foreigners, particularly those married to other skilled professionals, to Canada, which grants work authorisat...

15theditionofurbanmobilityindiaconferenceexpotoopeninkochitoday

15th edition of Urban Mobility India Conference & Expo to open in Kochi today

Kochi: The 15th edition of the Urban Mobility India Conference and Expo organised by the Ministry of Housing and Urban Affairs will open in Kochi toda...

benjaminnetanyahucomesbacktopowerinisrael

Benjamin Netanyahu comes back to power in Israel

Tel Aviv: Former Israeli Prime Minister Benjamin Netanyahu has made a stunning come back to power as his Likud party and its far-right and religious a...

sixgrainvesselsleaveukrainianportsafterrussiaresumesparticipationinunbrokereddeal

Six-grain vessels leave Ukrainian ports after Russia resumes participation in UN-brokered deal

Six-grain vessels left Ukrainian ports on Thursday after Russia resumed its participation in the UN-brokered deal which allows grain exports through t...

northkoreafiresmultipleballisticmissilesincludingintercontinentalballisticmissile

North Korea fires multiple ballistic missiles including inter-continental ballistic missile

North Korea fired multiple ballistic missiles, including an inter-continental ballistic missile (ICBM), yesterday. It triggered an alert for residents...

defenceministerasksnavytomaintainfocusonfuturisticcapabilitydevelopmentinmaritimedomain

Defence Minister asks navy to maintain focus on futuristic capability development in maritime domain

New Delhi: Defence Minister Rajnath Singh has asked naval commanders to maintain focus on futuristic capability development for effectively overcoming...

telanganarecords9313%pollinginbyelection

Telangana records 93.13% polling in byelection

Munugode Assembly constituency reported 93.13 percent in by-poll in Telangana. The office of the Telangana Chief Electoral Officer stated that over 2 ...

twononlocallabourersshotatandinjuredbyterroristsinanantnagjk

Two non-local labourers shot at and injured by terrorists in Anantnag, J&K

Srinagar: In the Union Territory of Jammu and Kashmir, terrorists fired upon two non-local labourers, in south Kashmir's Anantnag district last evenin...

Displaying 46201 - 46230 of 120423 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Can Lionel Messi's visit boost Indian football?

Yes
No
Can't Say