logo
 
Displaying 34681 - 34710 of 122293 total results
apchiefministervisitskadapaameenpeerdargah

AP Chief Minister visits Kadapa Ameen Peer Dargah

Kurnool: Chief Minister Y.S. Jagan Mohan Reddy expressed his joy at visiting the Ameen Peer Dargah in Kadapa, a symbol of religious harmony and Sufi g...

pmmodiinteractswithapshgwoman

PM Modi interacts with AP SHG woman

Vijayawada: Prime Minister Narendra Modi interacted with a member of a women Self Help Group, who is a trained drone pilot, via video conferencing on ...

indiandiasporawelcomespmmodiinuaewithcheers

Indian diaspora welcomes PM Modi in UAE with cheers

Dubai [UAE]: Upon his arrival in the UAE, Prime Minister Narendra Modi received a warm welcome from the members of the Indian diaspora outside a hotel...

cyclonemaycrossnelloreondecember5

Cyclone May Cross Nellore on December 5

Visakhapatnam: The severe cyclonic storm might cross near Nellore on December 4 evening or the following morning, a report by IMD Amaravati stated on ...

brswillwin70plusseatssaysktr

BRS will win 70 plus seats, says KTR

Exuding confidence that the Bharat Rashtra Samithi (BRS) would win more than 70 seats, party working president KT Rama Rao dismissed the exit poll res...

telanganasees6435percentvoterturnouthyderabadrecords4088percent

Telangana sees 64.35 percent voter turnout, Hyderabad records 40.88 percent

Polling for the 2023 Assembly Elections in Telangana concluded peacefully on Thursday, with an approximate voter turnout of 64.35 percent being record...

telanganaatlessthanlastyearandhyderabadatworsteversaystelanganaelectionpollingpercentages

Telangana at less than last year and Hyderabad at worst ever, says Telangana Election Polling Percentages

Telangana Assembly Elections 2023 were quite peaceful and successful. While Medak and Jangaon registered the highest polling percentage so far, H...

tensionprevailsatsaidabadasgroupattackscongresscandidate

Tension prevails at Saidabad as group attacks Congress candidate

Mild tension prevailed at Saidabad during elections when a group of persons attacked Congress candidate from Malakpet, Shaik Akbar near a polling stat...

telanganarecords6394percentvoterturnoutby5pm

Telangana records 63.94 percent voter turnout by 5 pm

Telangana has registered an approximate voter turnout of 63.94 percent by 5 pm, a significantly lower figure than the 73.74 percent recorded in 2018.H...

pmmodileavesfordubaitoattendcop28climatesummit

PM Modi leaves for Dubai to attend COP28 climate summit

Prime Minister Narendra Modi left for Dubai on Thursday to attend the World Climate Action Summit at the 28th Conference of the Parties (COP28).The Pr...

cyclonemiachaunglikelytohittamilnaducoastalandhrapradeshondecember4:imd

Cyclone 'Miachaung' likely to hit Tamil Nadu, coastal Andhra Pradesh on December 4: IMD

A low-pressure area in the Bay of Bengal and the South Andaman Sea will intensify into a cyclone and reach Tamil Nadu and Andhra Pradesh on December 4...

french‘spiderman’climbsburjkhalifa

French ‘spiderman’ climbs Burj Khalifa

French climbers, Alain Robert, known as the “French Spiderman”, and Alexis Landot climbed an 828-meter-high (2,716.5 feet) Burj Khalifa in Dubai.This ...

50%discountontrafficfinesannouncedinuae

50% discount on traffic fines announced in UAE

In celebration of the United Arab Emirates (UAE) 52nd National Day, Fujairah Police has announced a 50 percent discount on traffic fines.The motorists...

aaptolaunch‘meibhikejriwal’signaturecampaignonfriday

AAP to launch ‘Mei Bhi Kejriwal’ signature campaign on Friday

The Aam Aadmi Party (AAP) on Thursday said that it will launch a signature campaign to get the public opinion — if Chief Minister Arvind Kejriwal is a...

104yearoldwomancastshervoteinsiddipet

104-year old woman casts her vote in Siddipet

A 104-year-old woman cast her vote in Siddipet constituency.The woman, Johara Bi, a resident near Borra Hanuman Temple in Siddipet town, cast her vote...

israelhamastruceextendedforaday

Israel-Hamas truce extended for a day

Gaza Strip: A truce between Israel and Hamas will continue, both sides said Thursday, moments before the deal was due to expire, though details of any...

edcarriesoutraidsinrs250crcaserelatedtojkbank

ED carries out raids in Rs 250 cr case related to J-K Bank

Srinagar: The Enforcement Directorate on Thursday searched six places related to the Jammu and Kashmir Bank in connection with a Rs 250 crore money la...

pmmodiinteractswithbeneficiariesofviksitbharatsankalpyatra

PM Modi interacts with beneficiaries of 'Viksit Bharat Sankalp Yatra'

New Delhi: Prime Minister Narendra Modi on Thursday said people have immense confidence in his government after looking at his work for 10 years, as h...

googleunveilsbestappsandgamesof2023onplaystoreindia

Google unveils best apps and games of 2023 on Play Store India

New Delhi: Google on Thursday announced Play Store’s best apps and games of 2023 in India, which helped people through a range of critical needs.“In 2...

telanganaassemblyelections:voterturnoutrecordedover20pc

Telangana Assembly elections: Voter turnout recorded over 20 pc

Telangana recorded a voter turnout of 20.64 per cent till 11 am in the assembly polls that is currently underway for 119 seats, according to the Elect...

telanganaassemblyelections:cmkcrvotesinhometown

Telangana Assembly Elections: CM KCR votes in hometown

Telangana Chief Minister K Chandrasekhar Rao and his wife Sobha cast their ballot in Chinramadaka village in Siddipet district on Thursday.He greeted ...

appleunveilstop14appsandgamesof2023

Apple unveils top 14 apps and games of 2023

New Delhi: Apple on Thursday announced winners of the 2023 App Store Awards, recognising 14 apps and games that helped users create, discover new adve...

hyderabad’selectionofficialronaldrosevotes

Hyderabad’s Election Official Ronald Rose Votes

Hyderabad District Election Officer and GHMC Commissioner Ronald Rose along with his wife exercised their right to vote at the Venkateswara Fine Arts ...

pollingdelayedinsomepollingstationsinjagtial

Polling delayed in some polling stations in Jagtial

Jagtial: Polling was delayed in a few polling stations in the district following EVMs developing technical snags.Polling was delayed in booth number 3...

revanthreddycastshisvoteinkodangal

Revanth Reddy casts his vote in Kodangal

Telangana Pradesh Congress Commitee (TPCC) president Revanth Reddy cast his vote in Kodangal. He is contesting from two Kamareddy and Kodangal Assembl...

barristerasaduddinowaisicastshisvoteunderrajendranagarassemblyconstituency

Barrister Asaduddin Owaisi Casts his Vote Under Rajendranagar Assembly Constituency

All India Majlis-e-Ittehadul Muslimeen president and Hyderabad MP Asaduddin Owaisi casts his vote at St.Faiz school under Rajendranagar assembly const...

governmentcallsallpartymeetingonsaturday

Government calls all party meeting on Saturday

Ahead of Winter Session of Parliament beginning on Monday, the government has called an all party meeting on Saturday to ensure smooth functioning of ...

pmnarendramoditointeractwithbeneficiariesofcentralwelfareschemesunderongoingviksitbharatsankalpyatra

PM Narendra Modi to interact with beneficiaries of central welfare schemes under ongoing Viksit Bharat Sankalp Yatra

Prime Minister Narendra Modi will interact with beneficiaries of central government’s welfare schemes today through virtual mode under the ongoing Vik...

indianandaustralianarmedforcesconductedjointmilitaryexerciseaustrahind2023inaustralia

Indian and Australian armed forces conducted Joint Military Exercise AustraHind 2023 in Australia

Indian and Australian armed forces on Wednesday conducted tactical exercises in multi-domain operations in urban and semi-urban terrain during the Joi...

unioncabinetapprovescontinuationoffasttrackspecialcourtsuptomarch2026

Union Cabinet approves continuation of Fast-track Special Courts up to March 2026

New Delhi: The Union Cabinet has approved the continuation of the Fast Track Special Court (FTSCs) for a further three years. It has been extended til...

Displaying 34681 - 34710 of 122293 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand