logo
 
Home > Sports > Cricket
Displaying 3811 - 3840 of 8065 total results
srilankacricketsuspendchamikakarunaratnefromallformsofcricketforoneyear

Sri Lanka Cricket suspend Chamika Karunaratne from all forms of cricket for one year

Sri Lanka Cricket (SLC) on Wednesday handed Chamika Karunaratne a one-year suspension ban for violating multiple terms of the Player Agreement during ...

icct20irankings:suryakumaryadavreignssupremeatno1hardikpandyaenterstop50batters

ICC T20I Rankings: Suryakumar Yadav reigns supreme at no.1, Hardik Pandya enters top 50 batters

India batter Suryakumar Yadav still reigned supreme at no.1 in the recent update of the ICC T20I players’ rankings on November 23, 2022. On the other ...

indvsban:ravindrajadejareplacedbyshahbazahmedforthreematchodiseries

IND vs BAN: Ravindra Jadeja replaced by Shahbaz Ahmed for three-match ODI series

The All-India Senior Selection Committee has named fast bowler Kuldeep Sen and all-rounder Shahbaz Ahmed as replacements for Yash Dayal & Ravindra...

newcaptainhardikpandyaraiseshopeinarainhittiethathandedasequencewintoindia

New captain Hardik Pandya raises hope in a rain-hit tie that handed a sequence win to India

A T20 sequence win towards New Zealand underneath a brand new captain, coming carefully on the heels of an embarrassing T20 World Cup exit. A notion o...

3rdodi:australiascriptseriessweepwithmassive221runwinoverengland

3rd ODI: Australia script series sweep with massive 221-run win over England

Travis Head and David Warner scored brilliant hundreds and forged a record opening stand- 269 runs - to power Australia to a thumping 221-run victory ...

newzealandwintossopttobatagainstindiain3rdt20i

New Zealand win toss opt to bat against India in 3rd T20I

Napier: New Zealand won the toss and opted to bat first against India in the third and final T20I at Napier on Tuesday.While India have made one chang...

thirdt20internationalofseriesbetweenindiaandnewzealandtobeplayedtoday

Third T-20 International of series between India and New Zealand to be played today

Napier: The third and final T-20 International of the series between India and New Zealand will be played at McLean Park in Napier today. The match wi...

qatar2022:australiasmartinboyleruledoutwithinjuryatworldcup

Qatar 2022: Australia's Martin Boyle ruled out with injury at World Cup

Australia winger Martin Boyle has been ruled out of the World Cup because of a knee injury.The team announced that Marco Tilio will take his place on ...

pcbannounces18mansquadforupcominghometestsagainstengland

PCB announces 18-man squad for upcoming home Tests against England

Babar Azam's Pakistan team ended the World Cup on a pretty high note. They did end up on the losing side in the finals, but considering their chances ...

vijayhazaretrophy:njagadeesanscriptshistorybreakskohlisrecordwith5thconsecutivehundred

Vijay Hazare Trophy: N Jagadeesan scripts history, breaks Kohli's record with 5th consecutive hundred

Records were broken left, right and center on Monday (November 21) as N Jagadeesan scored a blistering double hundred against Arunachal Pradesh in the...

nzvsind:suryakumaradvancesinmultiplechartsafter51ball111

NZ vs IND: Suryakumar advances in multiple charts after 51-ball 111

Suryakumar Yadav, on Sunday, November 20, scored an unbeaten 111 off 51 balls with the help of 11 fours and seven sixes in the second T20I against New...

nzvsind2ndt20i:indiadefeatnewzealandby65runs

NZ vs IND, 2nd T20I: India defeat New Zealand by 65 runs

We can use any and all adjectives we want, but none of them will be able to justify the kind of innings Suryakumar Yadav played at Bay Oval vs New Zea...

cheteshwarpujarafinallygetsarjunaaward

Cheteshwar Pujara finally gets Arjuna award

India batter Cheteshwar Pujara has been presented with the prestigious Arjuna award five years after he was recommended for the honour. Pujara could n...

bccisackschetansharmaledselectioncommitteeaftert20worldcupdisappointments

BCCI sacks Chetan Sharma-led selection committee after T20 World Cup disappointments

BCCI has sacked India's national selection committee led by former India pacer Chetan Sharma after the T20 World Cup disappointments, reported news ag...

rcbcanwin234ipltitlesquicklyiftheymanagetowintheirfirst:abdevilliers

RCB can win 2,3,4 IPL titles quickly if they manage to win their first: AB de Villiers

Former Royal Challengers Bangalore star AB de Villiers feels that the Bangalore-based team can win multiple Indian Premier Leagues if they can bag the...

indiavsnewzealand:firstt20icalledoffduetoincessantrain

India vs New Zealand: First T20I called off due to incessant rain

The first T20 International of the three-match series between India and New Zealand was called off without a ball being bowled as incessant rain made ...

teamindiatotakeonnewzealandin3matcht20series

Team India to take on New Zealand in 3 match T20 Series

India v New Zealand series will begin on Friday with the first T20I at the SKY Stadium in Wellington. For the T20I series, big names like Rohit Sharma...

firstt20betweenindiaandnewzealandtobeplayedatwellingtontoday

First T20 between India and New Zealand to be played at Wellington today

Wellington: India will take on New Zealand in the 1st T20 match of the three-match series today. The match at Sky Stadium in Wellington will begin at ...

indianplayerspoonamyadavdeeptisharmasnehranaandpoojavastrakarnamedcaptainsinwomen’st20challenger

Indian players Poonam Yadav, Deepti Sharma, Sneh Rana and Pooja Vastrakar named captains in Women’s T20 Challenger

India captain Harmanpreet Kaur has been rested from the Senior Women's Challenger T20 Trophy, to be played in Raipur from November 20. With Harmanpree...

msdhoniregistersyetanotherachievementmensdoublestitleatjsca

MS Dhoni registers yet another achievement, men's doubles title at JSCA

Be it on the field, or away from it, you just can't keep MS Dhoni out of the spotlight. The former India captain who enjoys a superstar stature has ma...

babarazamshouldquitpakistant20icaptaincyfocusonlongerformats:shahidafridi

Babar Azam should quit Pakistan T20I captaincy, focus on longer formats: Shahid Afridi

Former Pakistan all-rounder Shahid Afridi has urged Babar Azam to give up T20I captaincy and focus on leading the side in the longer formats of the ga...

ipl2023:punjabkingsannouncesigningofwasimjafferasnewbattingcoach

IPL 2023: Punjab Kings announce signing of Wasim Jaffer as new batting coach

Former India batter Wasim Jaffer has been appointed as the new batting coach for Punjab Kings for the upcoming season of the Indian Premier League. Me...

bordergavaskartrophy:delhilikelytohostindiavsaustraliatestmatchnextyear

Border-Gavaskar trophy: Delhi likely to host India vs Australia Test match next year

Delhi will be hosting a Test match after more than five years when Pat Cummins' Australia travel to India for the high-profile Border-Gavaskar four-ma...

englandtourofpakistan:pcblikelytochangevenueforfirsttestduetoongoingpoliticalchaos

England tour of Pakistan: PCB likely to change venue for first Test due to ongoing political chaos

The Pakistan Cricket Board (PCB) could be forced to move the venue for the first Test match against England, that kick starts on December 1 after poli...

suryakumarretainstopspotint20battingrankings

Suryakumar retains top spot in T20 batting rankings

India middle-order batter Suryakumar Yadav has retained his top position in the ICC men's T20I batting rankings issued on Wednesday, following his ste...

kieronpollardretiresfromiplappointedasbattingcoachofmi

Kieron Pollard retires from IPL, appointed as batting coach of MI

Mumbai Indians cricketer Kieron Pollard has retired from the Indian Premier League. The all-rounder shared an emotional message on his Twitter handle ...

patcumminsalexhalesandsambillingswillbeunavailableforipl2023confirmskkr

Pat Cummins, Alex Hales and Sam Billings will be unavailable for IPL 2023, confirms KKR

Two-time IPL Champions Kolkata KnightRiders have confirmed the departures of Pat Cummins, Sam Billings and Alex Hales ahead of the IPL 2023 auction.Cu...

ipl2023retention:punjabkingspartwayswithformercaptainmayankagarwalaftermediocre2022

IPL 2023 Retention: Punjab Kings part ways with former captain Mayank Agarwal after mediocre 2022

Punjab Kings (PBKS) on Tuesday released their former captain Mayank Agarwal ahead of the auction for IPL 2023. Agarwal's association with the Punjab K...

iwillbeputtingupmynameiniplauctionsthistime:englandsadilrashid

I will be putting up my name in IPL auctions this time: England's Adil Rashid

England spinner Adil Rashid has said he will be putting his name in for the upcoming IPL auction. Rashid’s comments came after England beat Pakistan b...

viratkohlisuryakumarinicc’smostvaluableteamoft20worldcup

Virat Kohli, Suryakumar in ICC’s Most Valuable Team of T20 World Cup

Melbourne: Charismatic India cricketers Virat Kohli and Suryakumar Yadav have made it to the ICC’s ‘Most Valuable Team of the Tournament’, which has b...

Displaying 3811 - 3840 of 8065 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Where should be the burial of the pilgrims martyred in the Saudi Arabia bus accident?

Madinah Shareef
Hyderabad
Can't Say