logo
 
Displaying 5521 - 5550 of 10025 total results
salmankhansharesnewlookfromkisikabhaikisikijaan

Salman Khan shares new look from Kisi Ka Bhai Kisi Ki Jaan

Salman Khan had a Dussehra surprise for his fans. The actor shared a new look from his upcoming film Kisi Ka Bhai.. Kisi Ki Jaan. His new and fresh lo...

aliabhattsbabyshowerceremonybeinghoistedinvastu

Alia Bhatt's baby shower ceremony being hoisted in Vastu

Alia Bhatt is expecting to be a mother soon. The Bollywood star announced her pregnancy in June earlier this year after tying the knot with Ranbir Kap...

chiranjeevisalmankhanstarrer‘godfather’finallyhittheatrestoday

Chiranjeevi-Salman Khan starrer ‘God Father’ finally hit theatres today

The much-awaited film ‘God Father’ has finally hit the theatres today. Directed by Mohan Raja, the film, which is touted to be political action entert...

angelinajolieaccusesbradpittofchokinghittingtheirchildren

Angelina Jolie accuses Brad Pitt of choking, hitting their children

The fight between Hollywood stars Angelina Jolie and her ex-husband Brad Pitt is getting uglier with each passing day. The 'Girl, Interrupted' star ha...

internetsensationkilipaultoenterbiggboss16

Internet sensation Kili Paul to enter Bigg Boss 16

The popular reality show hosted by superstar Salman Khan started with a grand premiere on October 1. The show amasses a massive fan base from differen...

englishvinglishfilmcompletes10yearssridevissareesworntobeauctioned

English Vinglish film completes 10 years, Sridevi's sarees worn to be auctioned

Sridevi was one of Indian cinema's most celebrated names. The pan-Indian star enjoyed a strong fan following due to her electrifying screen presence a...

englishvinglishfilmcompletes10yearssridevissareesworntobeauctioned

English Vinglish film completes 10 years, Sridevi's sarees worn to be auctioned

Sridevi was one of Indian cinema's most celebrated names. The pan-Indian star enjoyed a strong fan following due to her electrifying screen presence a...

richachadhaalifazalarelegallymarriedfor25yearscoupleissuesclarification

Richa Chadha & Ali Fazal are legally married for 2.5 years, couple issues clarification

Richa Chadha and Ali Fazal's wedding has become the talk of town. There have been speculations that the couple will tie the knot in Mumbai soon. Amids...

saraalikhantoplayleadinaewatanmerewatanrevealsvarundhawan

Sara Ali Khan to play lead in Ae Watan Mere Watan, reveals Varun Dhawan

Varun Dhawan announced Sara Ali Khan as the lead of Prime Video’s upcoming Amazon Original film, Ae Watan Mere Watan. It is produced by Karan Johar's ...

amitabhbachchanpraisesindiasoscarentrychhelloshow

Amitabh Bachchan praises India's Oscar entry Chhello Show

The Film Federation of India recently announced India's official entry to the Oscars 2023. The Gujarati film, Chhello Show, which is titled Last Film ...

makersofgoodbye’sannouncestosellfilmticketsatrs150onreleaseday

Makers of Goodbye’s announces to sell film tickets at Rs 150 on release day

Amitabh Bachchan and Rashmika Mandanna’s film Goodbye is all set to release on October 7. Ahead of the release, the makers have announced that the tic...

makersofgoodbye’sannouncestosellfilmticketsatrs150onreleaseday

Makers of Goodbye’s announces to sell film tickets at Rs 150 on release day

Amitabh Bachchan and Rashmika Mandanna’s film Goodbye is all set to release on October 7. Ahead of the release, the makers have announced that the tic...

kajolstarrersalaamvenkytoreleaseintheatresondecember9

Kajol-starrer Salaam Venky to release in theatres on December 9

Salaam Venky, directed by Revathy, is slated to be released in theatres on December 9. Headlined by Kajol, the film is billed as an incredible true st...

urmilamatondkartomakeherdigitaldebutwiththrillerwebseriestiwari

Urmila Matondkar to make her digital debut with thriller web-series 'Tiwari'

Actor Urmila Matondkar is all set to make her digital debut with an action-packed thriller web series Tiwari, where she’ll also be performing some gri...

randeephoodabeginsshootingforveersavarkarbiopic

Randeep Hooda begins shooting for Veer Savarkar biopic

Actor Randeep Hooda on Monday said he has started shooting for SwatantryaVeer Savarkar, a biopic of Hindutva ideologue V D Savarkar. It also marks the...

prabhaskritisanonstarreradipurushteaserout

Prabhas, Kriti Sanon starrer Adipurush teaser out

Ever since its inception, Adipurush has garnered massive attention from the audience. It is touted to be one of the most expensive films made in India...

alluarjunlaunchesgrandfathersbookwithmvenkaiahnaiduchiranjeeviramcharan

Allu Arjun launches grandfather's book with M Venkaiah Naidu, Chiranjeevi, Ram Charan

South superstar Allu Arjun is a complete family person. Be it travelling with his family on wife Sneha Reddy’s birthday to spending time with his kids...

kareenakapoorsaifalikhanbuymercedezbenzworthrs2crore

Kareena Kapoor-Saif Ali Khan buy Mercedez-Benz worth Rs 2 crore

Kareena Kapoor Khan and Saif Ali Khan have bought another swanky car. Kareena and Saif's new Mercedez-Benz is worth Rs 2 crore. Just a few days ago, t...

vijaysethupathitofeatureinsilentfilmgandhitalks

Vijay Sethupathi to feature in silent film 'Gandhi Talks'

Zee Studios on Sunday announced a silent film, titled Gandhi Talks with actor Vijay Sethupathi. It also stars Aditi Rao Hydari, Arvind Swami and Siddh...

biggboss16beginssalmankhanreturnsashost

Bigg Boss 16 begins, Salman Khan returns as host

Salman Khan is all set to kick-start the new season of the reality show Bigg Boss. It will air on Colors TV and Voot Select. The show has skyrocketed ...

ramcharantofeatureincameoinkisikabhaikisijijaanconfirmssalmankhan

Ram Charan to feature in cameo in Kisi Ka Bhai Kisi Ji Jaan, confirms Salman Khan

Salman Khan is presently working on his next film Kisi Ka Bhai Kisi Ki Jaan and while promoting Chiranjeevi’s God Father on Saturday, the Bigg Boss ho...

chiranjeeviandsalmankhansactionpackedpoliticaldramagodfathertrailerout

Chiranjeevi and Salman Khan's action-packed political drama Godfather trailer out

The much-awaited movie, Godfather's Hindi trailer is out today and fans are going gaga over the action sequence. Now apart from Telegu, we can enjoy t...

ajaydevgnsfilmmaidaantoreleasein2023checkdatehere

Ajay Devgn's film Maidaan to release in 2023, check date here

Superstar Ajay Devgn on Saturday announced that his highly-anticipated film “Maidaan” will now arrive in theatres on February 17, 2023.Based on the go...

salmankhansbodydoublesagarpandeypassesawayactorpostsheartfeltcondolence

Salman Khan's body double Sagar Pandey passes away, actor posts heartfelt condolence

Salman Khan’s body double Sagar Pandey passed away while working out at the gym on September 30. He had worked with the superstar in over 50 of his fi...

ajaydevgnsuriyahonouredwithbestactorat68thnationalfilmawardsceremony

Ajay Devgn, Suriya honoured with Best Actor at 68th National Film Awards Ceremony

The winners of the 68th National Film Awards were announced on July 22. The National Award for Best Actor was jointly won by Suriya for Soorarai Pottr...

ranimukerjiscandidautobiographytobereleasedin2023onherbirthday

Rani Mukerji's candid autobiography to be released in 2023 on her birthday

Rani Mukerji is one of the finest actors in Indian cinema. Over the years, the actress has given several cult classics. After gaining unparalleled fam...

varundhawanandkritisanonstarrerbhediyatrailertobeout19thoctober

Varun Dhawan and Kriti Sanon starrer Bhediya trailer to be out 19th October

The Varun Dhawan and Kriti Sanon starter 'Bhediya' has been the most anticipated movie of the year. Ever since the team started sharing glimpses of th...

veteranactressashaparekhhonouredwithdadasahebphalkeaward

Veteran actress Asha Parekh honoured with Dada Saheb Phalke Award

Veteran actress Asha Parekh was honoured with the Dada Saheb Phalke award today (September 30) in New Delhi. This is the highest recognition in the fi...

filmheritagefoundationannouncefilmfestivaltocelebrateamitabhbachchans80thbirthday

Film Heritage Foundation announce film festival to celebrate Amitabh Bachchan's 80th birthday

Film Heritage Foundation on Friday announced a film festival to celebrate Amitabh Bachchan's 80th birthday, as a part of which movies featuring the me...

iifa2023tobeheldinabudhabicheckdates

IIFA 2023 to be held in Abu Dhabi, check dates

The International Indian Film Academy (IIFA) on Thursday announced that its upcoming 23rd edition of IIFA Weekend and Awards will be held in Yas Islan...

Displaying 5521 - 5550 of 10025 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand