logo
 
Home > Entertainment
Displaying 4711 - 4740 of 11131 total results
rishisinghwonindianidol13takeshomeacarandrs25lakhprizemoney

Rishi Singh won Indian Idol 13, takes home a car and Rs 25 lakh prize money

The winner of Indian Idol 13 has finally been announced. The battle, that went on for over half a year, has finally found the one who will walk away w...

ambanisservedfoodinsilverthalistoguestsatnmacc

Ambanis served food in Silver thalis to guests at NMACC

Nita Mukesh Ambani Cultural Centre (NMACC) Gala saw the who-is-who of Bollywood descend upon the venue. Bollywood and Hollywood celebrities marked the...

tamilstarthalapathyvijaymakeshisinstadebutgetsover500kfollowerswithinfirsthour

Tamil star Thalapathy Vijay makes his Insta debut, gets over 500k followers within first hour

Thalapathy Vijay’s fans have a reason to rejoice. The Tamil actor, who was last seen in Varisu, is now on the social media platform, Instagram. The ac...

varundhawanmadeherbollywooddreamcometrueatnmaccsaysgigihadid

Varun Dhawan made her Bollywood dream come true at NMACC, says Gigi Hadid

On Day 2 of Nita Mukesh Ambani Cultural Centre launch event held on April 1, American supermodel Gigi Hadid was invited as a guest. She got a grand Bo...

amidweddingrumoursparineetichopraandaapmlaraghavchadhaspottedtogether

Amid wedding rumours, Parineeti Chopra and AAP MLA Raghav Chadha spotted together

Actress Parineeti Chopra and AAP leader Raghav Chadha sparked dating rumours after being spotted together on lunch and dinner dates. The photos and vi...

aliabhattjoinsrashmikamandannatodancetonaatunaatuatnmacclaunchday2

Alia Bhatt joins Rashmika Mandanna to dance to Naatu Naatu at NMACC launch Day 2

Rashmika Mandanna is on a roll. Right after the actress delivered an electrifying performance on the opening night of the Indian Premiere League in Gu...

iwould‘love’tobeinanuragbasu’saashiqui3sayssaraalikhan

I would ‘love’ to be in Anurag Basu’s Aashiqui 3, says Sara Ali Khan

The Aashiqui franchise is getting its third film and the same was announced in 2022. With filmmaker Anurag Basu at the helm, the film will be led by a...

biggbossisscriptedseveralcontestantstake‘psychiatrichelp’aftershow:apurvaagnihotri

'Bigg Boss is scripted', several contestants take ‘psychiatric help’ after show: Apurva Agnihotri

It was in Season 7 of the popular reality show, Bigg Boss, that the audience saw TV couple Apurva and Shilpa Agnihotri. The couple had conducted thems...

‘legendrespectinglegend’callsfansafterarijitsinghtouchesmsdhoni’sfeetatipl2023openingceremony

‘legend respecting legend’ calls fans after Arijit Singh touches MS Dhoni’s feet at IPL 2023 opening ceremony

The opening ceremony of Indian Premier League (IPL) 2023 saw performances by Arijit Singh, Tamannaah Bhatia and Rashmika Mandanna. The celebrities set...

actressrakhisawantunderfirefordisrespectingramzanislam

Actress Rakhi Sawant under fire for disrespecting Ramzan, Islam

Rakhi Sawant, who has become famous for her controversial statements and actions, knows how to grab attention and make headlines every day. Her bold a...

rashmikamandannatoperformatipl2023’sopeningceremony

Rashmika Mandanna to perform at IPL 2023’s opening ceremony

Rashmika Mandanna is widely regarded as one of South cinema's most popular stars. Fans adore her because of her stylish reel image and sincere perform...

arjunrampalsdaughtermyrawalksherfirstrunwayfordior

Arjun Rampal's daughter Myra walks her first runway for Dior

Arjun Rampal and his ex-wife Mehr Jesia have been supermodels and ruled the ramp once. So, when their daughter walked the runway for Christian Dior, i...

pmmodimeetsguneetandkartikiaftertheelephantwhisperersoscarwinsaystheyhavemadeindiaproud

PM Modi meets Guneet and Kartiki after The Elephant Whisperers' Oscar win, says 'they have made India proud'

Guneet Monga and Kartiki Gonsalves brought immense pride to the country after their documentary, The Elephant Whisperers, won the Oscars at the 95th A...

bombayhcorderstorejectfirregisteredagainstsalmankhanon2019assaultcase

Bombay HC orders to reject FIR registered against Salman Khan on 2019 assault case

Bollywood superstar Salman Khan gets big relief from the Bombay High Court in connection to the 2019 assault case. The actor is exempted from appearin...

mahhivijtestscovid19positive

Mahhi Vij tests COVID-19 positive

Popular TV star, Mahhi Vij has shared a video on her Instagram handle informing her fans that she has tested positive for Covid 19. The actress has sh...

tollywoodsuperstarnagachaitanyavisitscafe555forhaleem

Tollywood superstar Naga Chaitanya visits Cafe 555 for Haleem

Hyderabad: Akkineni Naga Chaitanya, one of the most popular actors in the Telugu film industry, recently made a surprise visit to Cafe 555, located in...

amidweddingrumoursparineetichopraandraghavchadhaspottedatdelhiairport

Amid wedding rumours, Parineeti Chopra and Raghav Chadha spotted at Delhi airport

New Delhi: Amid wedding rumours, actor Parineeti Chopra and Aam Aadmi Party leader Raghav Chadha were spotted together at the Delhi airport on Wednesd...

maniratnamsponniyinselvan2trailerout

Mani Ratnam's Ponniyin Selvan 2 trailer out

After the success of Mani Ratnam's Ponniyin Selvan 1, the makers are yet back with the much-awaited sequel. The film which ruled the box office last y...

mithunchakrabortygrooveswithsonnamashiinbadboysongjanabeali

Mithun Chakraborty grooves with son Namashi in Bad Boy song Janabe Ali

Mithun Chakraborty‘s son Namashi Chakraborty will soon be seen in the Zee Studios movie Bad Boy. Ahead of the film’s release, the makers released a ne...

sushmitasenwrapsdubbingfortaalipostheartattackrecovery

Sushmita Sen wraps dubbing for Taali post heart attack recovery

On March 2, Sushmita Sen dropped a post on Instagram and shook everyone. Otherwise known as one of the fittest in the industry, the actress informed a...

actorkarankundrrahostsiftarpartyinmumbai

Actor Karan Kundrra hosts Iftar party in Mumbai

Television Actor Karan Kundrra, who is currently shooting for ‘Tere Ishq Mein Ghayal’, hosted a lavish Iftar party on the sets of the show. Videos and...

ponniyinselvan2trailertoreleaseonthisdatecheckhere

Ponniyin Selvan 2 trailer to release on THIS date, check here

Ponniyin Selvan emerged as one of the biggest hits of 2022 and received rave reviews with critics praising the effective performances and impressive p...

poojabhatttestspositiveforcovid19urgeseveryonetowearmask

Pooja Bhatt tests positive for Covid-19, urges everyone to wear mask

Actor-director Pooja Bhatt, took to her social media handles to inform people that she has tested positive for Covid-19. She advised everyone to mask ...

ajithkumarsfathersubramaniampassesawayat85

Ajith Kumar's father Subramaniam passes away at 85

Ajith Kumar's father Subramaniam breathed his last on March 24 in Chennai. He was 85. Ajith Kumar's fans took to social media to offer condolences to ...

policearrestmanwhostolers72lakhsfromsonunigam’sfather

Police arrest man who stole Rs 72 lakhs from Sonu Nigam’s father

The case of theft at the house of Agam Kumar Nigam, who is Bollywood singer Sonu Nigam’s father, has been solved by the Mumbai police. The accused has...

salmankhanskolkatashowpostponednotcancelledconfirmsorganiser

Salman Khan's Kolkata show postponed, not cancelled, confirms organiser

Salman Khan is still scheduled to appear in Kolkata. The actor will perform in the city between May and June, according to one of the show's organiser...

atifaslamblessedwithababygirlnamedherhalima

Atif Aslam blessed with a baby girl, named her Halima

Ace singer Atif Aslam and his wife Sara Bharwana became parents to a baby girl. The couple has two sons Abdul Ahad and Aryaan Aslam. They have named t...

anushkasharmaviratkohlilaunchnonprofitinitiativecouplesayswillcontinuetostriveforsocialgood

Anushka Sharma-Virat Kohli launch non-profit initiative, couple says 'will continue to strive for social good'

Anushka Sharma and cricketer Virat Kohli on Thursday announced their non-profit initiative SeVVA, which the couple said is aimed at helping those in n...

policefinduklinkinemailsenttosalmankhandeaththreatprobeon

Police find UK link in email sent to Salman Khan death threat, probe on

Mumbai Police probing the threat e-mail case received by the Bollywood actor, have found a British link. While not much information is available about...

akshaykumargetsinjuredwhileshootingactionsequenceforbademiyanchotemiyan

Akshay Kumar gets injured while shooting action sequence for 'Bade Miyan Chote Miyan'

The Khiladi of Bollywood is known for performing high-octane action sequenced by his own. It is also said that 95% of stunts are done by Akshay Kumar ...

Displaying 4711 - 4740 of 11131 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Can Lionel Messi's visit boost Indian football?

Yes
No
Can't Say