logo
 
Displaying 241 - 270 of 122416 total results
underconstructionbridgecollapsesingopalganjbihar

Under-construction bridge collapses in Gopalganj, Bihar

A portion of an under-construction small bridge collapsed in Bihar’s Gopalganj district, an official said on Monday, March 2.No one was injured in the...

manrescuedafterfallingintoventilationductinhyderabad

Man rescued after falling into ventilation duct in Hyderabad

A 40-year-old man was rescued after he accidentally fell into a ventilation duct from the terrace of a residential building in Padmanabha Nagar, Hyder...

edseizesrs1463crorepropertiesinhyderabadrealestatescam

ED seizes Rs. 14.63 crore properties in Hyderabad 'Real Estate Scam'

The Hyderabad Zonal Office of the Directorate of Enforcement (ED) has provisionally attached immovable assets worth Rs. 14.63 crore in connection with...

indiacanadadecidetoestablishdefencedialoguesayspmmodi

India, Canada decide to establish defence dialogue, says PM Modi

Prime Minister Narendra Modi said on Monday that India and Canada will work towards enhancing defence industries, maritime domain awareness and milita...

reportsclaimiran’sinterimleaderarafikilledinairstrike

Reports Claim Iran’s Interim Leader Arafi Killed in Airstrike

Social media posts and some Israeli news reports claim that Iran's interim Supreme Leader Alireza Arafi was killed in an airstrike just hours after ta...

keralacmpinarayislamstelanganagovtoverdemolitiondrive

Kerala CM Pinarayi Slams Telangana Govt Over Demolition Drive

Kerala Chief Minister Pinarayi Vijayan on Monday alleged that the recent reported demolition drive in Telangana's Khammam district reflects "bulldozer...

usfighterjetcrashesinkuwaitduringiranianmissileattack

US fighter jet crashes in Kuwait during Iranian missile attack

Iran state media claimed on Monday that a video showing a US fighter jet crashing over Kuwait is linked to the broader Iran-US conflict, as tensions c...

centregovtissuedacautionarylettertostatesagainstpossibleviolenceinindia

Centre govt issued a cautionary letter to States against possible violence in India

The Centre has issued a cautionary letter to States against possible violence in India in the wake of Israel-US strikes against Iran. Sources sai...

airindiaextendsflightsuspensiontouaesaudiarabiaisraelqatar

Air India Extends Flight Suspension To UAE, Saudi Arabia, Israel, Qatar

Air India has issued a travel advisory in view of the current situation in West Asia. The airline has extended the suspension of all flights to and fr...

ktrurgescmrevanthtocanceleauctiontendersofminesinsuryapet

KTR Urges CM Revanth to Cancel e-Auction Tenders of Mines in Suryapet

BRS working president KT Rama Rao has urged the Chief Minister A Revanth Reddy to immediately suspend the impugned e-auction tenders of mines in Surya...

twoschoolsgetbombthreatemailsinpunjab

Two schools get bomb threat emails in Punjab

At least two schools here received bomb threat emails on Monday, March 2, prompting authorities to carry out anti-sabotage checks, officials said.Poli...

gorillacostumeshelpsarpanchestacklemonkeymenaceinkarimnagar

Gorilla costumes help sarpanches tackle monkey menace in Karimnagar

With the monkey and dog menace emerging as a major challenge for newly elected sarpanches in rural areas of the erstwhile Karimnagar district, many ar...

pmnarendramodimeetscanadiancounterpartmarkcarney

PM Narendra Modi Meets Canadian Counterpart Mark Carney

Prime Minister Narendra Modi on Monday met his Canadian counterpart Mark Carney in the national capital. The two leaders met at Hyderabad House a...

telanganagovtsetsupscontrolroomindelhiamidmiddleeastcrisis

Telangana Govt sets ups control room in Delhi amid Middle East crisis

The Telangana government has established a 24×7 control room at Telangana Bhavan, New Delhi for Telangana citizens in view of the situation in the Mid...

srijanareviewssanitationworksincyberabad

Srijana Reviews Sanitation Works in Cyberabad

Cyberabad Municipal Corporation Commissioner G. Srijana on Monday conducted an inspection at various locations in Patancheru Circle including the Pata...

usdeploysb2bomberssuicidedronesanthropicaiiniranstrikes

US Deploys B-2 Bombers, Suicide Drones, Anthropic AI in Iran Strikes

The United States deployed an array of advanced weapons during strikes on Iran as part of Operation Epic Fury on Saturday, including artificial intell...

gulfflightopsfromkeralahitforthirddaywestasiaconflict

Gulf Flight Ops From Kerala Hit for Third Day 'West Asia Conflict'

Flight operations to Gulf countries from Kerala were affected for the third consecutive day on Monday following the conflict in West Asia, with author...

carcatchesfireaftercrashingintovanatlbnagarcrossroads

Car Catches Fire after Crashing into Van at LB Nagar Crossroads

A car went up in flames after ramming into a van at LB Nagar crossroads on Sunday midnight. The car driven by Sai Keerthan, a resident of Rock To...

pmmodichairscabinetcommitteeonsecuritymeetingiranisraelusconflict

PM Modi Chairs Cabinet Committee On Security Meeting 'Iran-Israel-US Conflict'

Prime Minister Narendra Modi chaired a meeting of the Cabinet Committee on Security at his residence yesterday. Home Minister Amit Shah, Defence ...

uaeclosesembassyintehranwithdrawsambassadorafteriranianmissileattacks

UAE Closes Embassy In Tehran, Withdraws Ambassador After Iranian Missile Attacks

The UAE has announced the closure of its embassy in Tehran and the withdrawal of its ambassador and all members of its diplomatic mission from Iran. T...

chinastronglycondemnedkillingofiranssupremeleaderkhamenei

China strongly condemned killing of Iran's Supreme Leader Khamenei

China strongly condemned the killing of Iran's Supreme Leader Ayatollah Ali Khamenei saying that it is a "grave violation" of Iran's sovereignty and s...

bindasswomenrun2026heldatjalaviharwaterpark

Bindass Women Run 2026 held at Jalavihar Water Park

The serene surroundings of Jalavihar Water Park transformed into a vibrant celebration of strength, unity, and empowerment as the Bindass Women Run 20...

willnotnegotiatewithunitedstatessaystopiransecurityofficial

Will not negotiate with United States, says Top Iran security official

Ali Larijani, Secretary of Iran’s Supreme National Security Council, on Monday dismissed reports that Tehran is seeking dialogue with the United State...

rahulgandhiandvenugopalarrivesinhyderabadcongressmeeting

Rahul Gandhi And Venugopal Arrives in Hyderabad 'Congress Meeting'

Congress MP Rahul Gandhi and MP KC Venugopal reached Hyderabad to participate in the party meeting in Vikarabad on Monday. Chief Minister A Revan...

uspresidenttrumpspeakswithisraelbahrainuaeleaders

US President Trump Speaks With Israel, Bahrain, UAE Leaders

President Donald Trump on Sunday spoke with the leaders of Israel, Bahrain and the United Arab Emirates as the US and Israel continued their strikes a...

usarabnationsslamtehransdronemissilestrikesinwestasia

US, Arab Nations Slam Tehran's Drone, Missile Strikes in West Asia

The United States and six Arab nations on Monday issued a strongly worded joint statement condemning Iran’s recent missile and drone attacks across We...

afghanistanhitskeypakistanmilitarybases

Afghanistan Hits Key Pakistan Military Bases

Amid escalating cross-border tensions between Afghanistan and Pakistan, the Ministry of National Defense of the Islamic Emirate announced that it had ...

upitransactionsrise27percentannuallyinfebruary

UPI Transactions Rise 27 Percent Annually In February

India’s retail payment infrastructure-the Unified Payments Interface (UPI) continued its rapid expansion in February with average daily transaction vo...

pmmoditellsnetanyahusafetyofciviliansutmostpriority

PM Modi Tells Netanyahu 'Safety Of Civilians Utmost Priority'

Prime Minister Narendra Modi spoke with Israeli Prime Minister Benjamin Netanyahu to discuss the current regional situation. He conveyed India’s conce...

kisnadiamondgoldjewelleryhostsmegacsrdriveacrosssouthindia

KISNA Diamond, Gold Jewellery Hosts Mega CSR Drive Across South India

KISNA Diamond & Gold Jewellery, the flagship diamond and gold jewellery brand from the Hari Krishna Group, successfully organised a Mega CSR Drive...

Displaying 241 - 270 of 122416 total results
etemaad live tv watch now

Todays Epaper

English Weekly

neerus indian ethnic wear
Latest Urdu News

Which cricket team is your favourite to win the T20 World Cup 2026?

India
South Africa
New Zealand